KEGG   Salmonella enterica subsp. arizonae: SARI_03109Help
Entry
SARI_03109        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
Organism
ses  Salmonella enterica subsp. arizonae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraG-D_C T4SS-DNA_transf DUF87 AAA_16 CobU AAA_22
Motif
Other DBs
NCBI-ProteinID: ABX22949
UniProt: A9MS47
Position
3028674..3030707
Genome map
AA seq 677 aa AA seqDB search
MRLDFILRPAVELYSASAALLAAVWCIVAPQMLLLTPYSGWLLALALIALSALRLKQGIR
ILRFRHRVRHLPLWTLSASRIPLLPDALFLGRGFRWLPTHTQRLYLCRLPQCEHWLRTDR
PSTSGGDPLLHGVELREGHVTLPLRDRPGHTLVLGTTRVGKTRLAELLIAQDIRRGDTVI
VFDPKGDADLLRRVWAEAHRAGRESVFWLFHLGWPEISARYNAVGRFGRISEVASRIAGQ
LSTEGNSAAFREFAWRFVNIITRALVALGQRPDYARIARHVINIDELFIDYARVFLPGHD
RQAWDNVVRIAGGITEKNTPRNLQGRDSYVVALEQYLSTTRLHDPILDGLRSAVRYDKTY
FDKIVASLLPLLEKLTTGKIAQLLAPDYGDLNDPRPVFDWQQAIRQRAIVYVGLDALSDA
EIAAAVGNSMFADLVSVAGHIYKHGVMDGLPQTEEKAAINLHCDEFSELMGDEFIPLINK
GGGAGVQVTAYTQTLSDIEARIGDRAKAGQVVGNFNSLIMMRVRETATAELLTKQLPQVD
VLSNSVSSGVTDSTDAQGNIGFSSNTQDRVSSVQVPLLEPASLVQLPKGQAFALLEGGQL
WKLRIPLPDAAHDPLMPENIAQIARDMEKQYDSAPVWWNRPEAVVTEKNDPILWLNDSET
TEKHTDDTPDTPPARER
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctcgattttatcctgcgcccggcggtggagctttacagcgccagcgcggccctg
ctggcggcagtatggtgcatcgtggcaccacaaatgctgctgctgacgccttattccggc
tggctgctggcgctggccttgattgcactgtctgccctgcggctaaaacaggggattcgc
atcctgcgctttcgccaccgcgtgcgccatctgccgctctggacgctctctgccagccgt
atcccgctgttacccgacgccctgtttctcgggcgcggctttcgctggctacccacgcat
acccagcggctgtatctgtgccgtctgccgcaatgcgagcactggctgcggacagaccgc
ccttccaccagcggcggcgatccgttgctgcacggcgtggaactgcgcgaaggccacgtc
acgttgccgctacgagaccgacccggacatacgttagtgctcggcaccacccgcgtcggt
aaaacccggctggcggagctgctgattgcccaggatattcgccgtggtgacacggtgatt
gtttttgatcccaagggtgatgccgacctgctgcgccgcgtgtgggcggaggcgcaccgc
gccggacgggaaagcgtcttctggctgttccatctcggctggccggagatttccgcccgc
tataacgccgtcgggcgctttggtcgcatctcggaggttgccagtcgcatcgccggacag
ctttccaccgaaggcaactcggccgccttccgcgagttcgcctggcgcttcgtcaacatc
atcacccgcgccctggtggcgctgggccagcgaccggattacgctcgcatcgcccgtcac
gttatcaatatcgacgaactgtttatcgactacgcccgcgtctttctgcccggtcacgac
cgccaggcatgggacaacgtggtacggattgccggtggcatcaccgagaaaaacacgccg
cgtaaccttcagggccgggacagctacgtcgtcgcgctggagcagtacctttccaccacc
cggctgcatgacccgatcctcgacggcctacgttctgccgtgcgctacgacaaaacctat
ttcgataagatcgtcgcctcgctgctgccgctgctggaaaaactgactaccgggaaaatc
gcgcaactgctagccccggactacggcgacctcaacgacccacgcccggtgtttgactgg
cagcaagcgattcgccagcgagcgattgtctatgtcgggctggatgcgctgtctgacgca
gagattgccgccgccgtgggtaactcgatgtttgccgatctggtcagcgtcgccgggcat
atctacaagcacggcgtgatggacggcctgccgcagacggaagaaaaagcagccatcaac
ctgcactgcgatgagttcagcgagctgatgggcgatgaatttattccgctaataaataaa
ggcggcggcgcgggcgtgcaggtcacggcctacacccagacgctctccgacatcgaggcc
cgcatcggcgatcgcgccaaagcgggccaggtggtcggcaacttcaacagcctgatcatg
atgcgggtacgggagactgccaccgccgaattgttgacgaagcaactgccgcaggtggat
gtgctcagcaacagcgtcagttccggcgtcaccgacagcactgacgctcagggtaatatc
gggttttccagcaacacccaagatcgcgtgagcagcgtacaagtgccgttactggaaccc
gcctcactggtacagctccccaaaggtcaggcgtttgctctgctggaaggcggccagctc
tggaaattacgtatcccgttaccggacgcagcgcacgatccgctgatgccggaaaacatc
gcgcaaatcgcccgtgatatggaaaaacaatacgacagcgcgcccgtatggtggaaccgc
ccggaggcagttgtaacggagaaaaacgaccctattttatggctgaacgacagcgaaacc
acggagaaacataccgatgataccccggacacaccgccagctcgtgagcgttga

DBGET integrated database retrieval system