KEGG   Salmonella enterica subsp. arizonae: SARI_03115
Entry
SARI_03115        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
Organism
ses  Salmonella enterica subsp. arizonae
SSDB
Motif
Pfam: Plasmid_RAQPRD
Other DBs
NCBI-ProteinID: ABX22955
UniProt: A9MS53
Position
3033731..3034102
AA seq 123 aa
MAIAFSANLQVKPILLQATSMLKVLLNIVSLFITSSAFAASLTEREELTLSLNQLTQIEA
SLHRAQKSARTGINERYYFDYPRIHSDITTLRSGIEHYLTPTRAQPRDTPTLVGQYREEK
TTP
NT seq 372 nt   +upstreamnt  +downstreamnt
atggccatcgcatttagcgcaaatttgcaggtaaaacccattctgttgcaggcaaccagc
atgcttaaagttctcctgaacattgtcagcctgtttataaccagttccgctttcgccgcc
tccctcaccgagcgcgaagagttaaccctgtccctcaaccagctaactcaaatcgaagcc
tcgctccaccgcgcccagaaaagcgccagaaccggcatcaacgagcgttactacttcgac
tatccgcgtatccatagcgatatcaccacgctgcgtagcgggattgaacattacctcacc
cccacccgcgcccagccgcgagatacgccaacgctggtcgggcaataccgtgaggagaaa
accacgccatga

DBGET integrated database retrieval system