KEGG   Salmonella enterica subsp. arizonae: SARI_03121
Entry
SARI_03121        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
Organism
ses  Salmonella enterica subsp. arizonae
SSDB
Motif
Pfam: TrbI Taxilin YabA DUF334
Other DBs
NCBI-ProteinID: ABX22961
UniProt: A9MS59
Position
3036433..3037770
AA seq 445 aa
MKLQANILLRVLTPLILLAGCVLLFHACQDRKTTPSTSSAPATPLSHDELKALGIEGDTP
ADTVATLVGQMKLWRKELETVKASNAALVQENQRLREREQNTDSRISEAINRQQTSASQQ
QNELLNSLQTQIQQLKGNRTTDDSLAGLGIDEPEAASGEPLRWIAPADALPTDKNGRPLQ
PALAFPSAMHSPTPQPEASPPAAVKPVYTLPQNSTLIGSVAMTALLGRIPLNGSVTDPYP
FKVLIGRDNLTANGIELPDIEGAVISGSATGDWTLSCVRGSLTSITFVFRDGTVRTLPAE
GDKTGSGTEGNIGWLSDPHGLPCIPGERKSNAAEYIGSQFLLAGSSAAAQALANNQTTST
VEDGSITTALTGDSGQYVLGQALGGGLKESADWFKQRYGQMFDAIYVPPGQAVAIHITRQ
LAIDYDPDGRRVNYRTAGERTGDLD
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgaagcttcaggccaatatcctgctgcgggttctgacgccgctcatcctgctggcgggc
tgcgtcctgctgtttcatgcctgtcaggatcgcaaaaccacaccgtcaacatcctctgcg
cctgcaacgcccctcagccacgacgagctgaaagcgctggggattgagggcgacacgccc
gccgataccgttgccacgctggtcggccagatgaaactctggcgcaaggaactggaaacg
gtaaaggccagtaatgccgcactggtgcaggaaaatcagcgcctgcgtgagcgcgagcag
aataccgacagccgcattagtgaggccattaaccgccagcaaaccagcgcctcacagcag
caaaacgaattgctcaactcgctacaaacgcagatccagcagcttaagggcaacagaaca
acggatgactcgctggccgggctgggaattgatgagccggaagcggcttcaggcgaacca
ctgcgctggatagcgcccgccgatgccctgccaaccgataaaaacggtcgtccgttgcaa
cctgcgctggcctttccttctgcgatgcatagccctacaccacaacctgaagcttcaccg
cccgccgccgtcaaaccggtctacaccctgccgcagaacagcacgttaatcggctcggtg
gcgatgaccgcgctgttggggcgcattccgcttaacggcagcgtcaccgatccttacccg
ttcaaggtgctgattggccgcgataacctcaccgccaacggcatcgagttgcccgatatt
gaaggcgcggtgatctccggcagcgccaccggcgactggacgctctcctgcgtacgcggg
agcttaacgtcaatcacctttgtcttccgcgacggcacggtacgcacgctgcctgctgaa
ggcgacaaaaccggaagcggcacggaaggcaatatcggctggctgtccgatcctcacggc
ctgccctgcatccccggcgaacgcaaatccaacgccgccgaatatatcggctcgcagttc
ctgctggccggatcgtccgctgccgcacaggcgctggcgaacaaccagaccacctccacc
gtggaagatggctccatcactaccgcgctgacgggcgacagcgggcagtacgtactcggc
caggcgctgggcggcggcctgaaggagagcgccgactggtttaagcagcgctacggccag
atgttcgacgccatttacgtgcctcccggccaggccgttgctatccatatcacccgccag
ttagccatcgactacgatcctgacggacggcgggtgaactaccgcacggcgggcgaacgc
actggagacctggactaa

DBGET integrated database retrieval system