KEGG   Salmonella enterica subsp. arizonae: SARI_03515
Entry
SARI_03515        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K02867  large subunit ribosomal protein L11
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ses00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SARI_03515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ses03011]
    SARI_03515
Ribosome [BR:ses03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SARI_03515
  Bacteria
    SARI_03515
  Archaea
    SARI_03515
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11 AAA_lid_3 DUF3140
Other DBs
NCBI-ProteinID: ABX23340
UniProt: A9MHF7
Position
complement(3449114..3449542)
AA seq 142 aa
MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEKGLPIPVVIT
VYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGA
DIEAMTRSIEGTARSMGLVVED
NT seq 429 nt   +upstreamnt  +downstreamnt
atggctaagaaagtacaagcctacgtcaagctgcaggttgcagctggtatggcgaacccg
agtccgccggttggtccagcactgggtcaacagggtgtgaacatcatggaattctgcaaa
gcgttcaacgcaaaaacggattccatcgaaaaaggtctgccgattccggttgttattacc
gtttacgctgaccgctctttcaccttcgttaccaaaacgcctccggcagctgttctgctg
aaaaaagcggctggtatcaagtctggttccggcaagccgaacaaagacaaagtaggtaaa
atttcccgcgctcagctgcaggaaatcgcgcagaccaaagctgccgacatgaccggtgcc
gacattgaagcgatgactcgctccatcgaaggtactgcacgttccatgggcctggtagtg
gaggactaa

DBGET integrated database retrieval system