KEGG   Salmonella enterica subsp. arizonae: SARI_03532Help
Entry
SARI_03532        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00471  D-Glutamine and D-glutamate metabolism
ses01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ses00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SARI_03532
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ses01011]
    SARI_03532
Enzymes [BR:ses01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     SARI_03532
Peptidoglycan biosynthesis and degradation proteins [BR:ses01011]
 Precursor biosynthesis
  Racemase
   SARI_03532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABX23348
UniProt: A9MHG5
Position
complement(3461764..3462546)
Genome map
AA seq 260 aa AA seqDB search
MLVFDSGVGGLSVYDEIRRLLPDLHYIYAFDNVAFPYGEKSETFIVERVVEIVTAVQQRY
PLSLAVIACNTASTVSLPALREKFAFPVVGVVPAIKPAARLTANGVVGLLATRATVKRPY
THELIARFANECQIAMLGSAELVELAEAKLHGDSVSLEELRRILRPWLRMPEPPDTVVLG
CTHFPLLRDELLQVLPEGTRLVDSGAAIARRTAWLLEHEAPDAKSTDANIAYCMAMTPGA
EQLLPVLQRYGFETLEKLAV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtatttgattccggcgtcggtggattgtcggtctatgatgagattcggcggctc
ctgccggatctccactatatatatgctttcgataacgtggcattcccctatggggaaaag
agcgaaacgtttatcgtcgagcgcgttgtcgagattgtgactgcggtacagcagcgctat
cccctttcactggcggtgatagcctgcaataccgccagtacggtttcacttcccgcatta
cgtgaaaagtttgccttcccggtggtgggcgttgtacctgcgattaaaccagcggcgcgg
cttaccgcaaatggcgtcgtcgggctactggcgacgcgagcgacggtcaaacgtccttat
actcacgaactgattgcgcgcttcgccaatgaatgtcagatagcgatgttggggtcggca
gaactggtggaactggcggaagctaaattacatggcgactcggtatcgctggaagagctg
cgccgcatattacgcccatggctacgaatgccggagccgcctgacacggtcgttctgggg
tgtacgcatttccctctattacgggacgagcttttgcaagtcctgcctgaagggacgcgg
ttagtggattccggcgcggcgatagcgcgtcgtacagcctggctgttggaacatgaagcg
ccggatgcgaaatcaaccgatgccaatattgcttattgcatggcaatgacgccaggagct
gaacaattattacccgttttacagcgttatggctttgaaacgctcgaaaaactggcggtt
taa

DBGET integrated database retrieval system