KEGG   Salmonella enterica subsp. arizonae: SARI_03576Help
Entry
SARI_03576        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00010  Glycolysis / Gluconeogenesis
ses00051  Fructose and mannose metabolism
ses00562  Inositol phosphate metabolism
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01120  Microbial metabolism in diverse environments
ses01130  Biosynthesis of antibiotics
ses01200  Carbon metabolism
ses01230  Biosynthesis of amino acids
Module
ses_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ses_M00002  Glycolysis, core module involving three-carbon compounds
ses_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SARI_03576
   00051 Fructose and mannose metabolism
    SARI_03576
   00562 Inositol phosphate metabolism
    SARI_03576
Enzymes [BR:ses01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SARI_03576
Exosome [BR:ses04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SARI_03576
  Exosomal proteins of bladder cancer cells
   SARI_03576
  Exosomal proteins of melanoma cells
   SARI_03576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: ABX23391
UniProt: A9MI45
Position
3511007..3511756
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELAGVAGCDVAIAPPEMYIDLAKRAAAGSHIMLGAQNV
DLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIV
KAAEAAKQA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgaactggtggctaacctg
cgtaaagaactggcgggcgtagcaggctgcgacgtggcaatcgctccgccggaaatgtat
atcgacctggcgaaacgcgctgctgccggtagccacatcatgctgggcgcgcagaacgtt
gacctgaacctgtccggcgcattcaccggtgaaacttcggctgaaatgctgaaagatatc
ggcgcgcagtacattattatcggccactccgagcgtcgtacttatcacaaagaatctgac
gagctgatcgccaaaaaattcgccgtgctgaaagaacaaggtctgacgccggtactgtgc
atcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaagaagtgtgcgcacgccag
atcgacgcggtactgaaaacgcagggcgcggcggcctttgaaggcgcggttatcgcttac
gaacccgtatgggcgatcggcaccggtaaatctgctaccccggctcaggcgcaggcggta
cacaaattcatccgcgaccacattgccaaagctgacgctaaaatcgctgagcaggtcatt
atccagtacggcggttccgtcaacgcgtccaacgcagccgaactgttcgcgcagccggac
atcgacggcgcgctggtaggcggcgcttctctgaaagctgacgccttcgccgtgatcgtg
aaagcagccgaagccgctaaacaggcttaa

DBGET integrated database retrieval system