KEGG   Salmonella enterica subsp. arizonae: SARI_04635Help
Entry
SARI_04635        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00071  Fatty acid degradation
ses00280  Valine, leucine and isoleucine degradation
ses00310  Lysine degradation
ses00362  Benzoate degradation
ses00380  Tryptophan metabolism
ses00620  Pyruvate metabolism
ses00630  Glyoxylate and dicarboxylate metabolism
ses00640  Propanoate metabolism
ses00650  Butanoate metabolism
ses00900  Terpenoid backbone biosynthesis
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01120  Microbial metabolism in diverse environments
ses01130  Biosynthesis of antibiotics
ses01200  Carbon metabolism
ses01212  Fatty acid metabolism
ses02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ses00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SARI_04635
   00630 Glyoxylate and dicarboxylate metabolism
    SARI_04635
   00640 Propanoate metabolism
    SARI_04635
   00650 Butanoate metabolism
    SARI_04635
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SARI_04635
   00072 Synthesis and degradation of ketone bodies
    SARI_04635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SARI_04635
   00310 Lysine degradation
    SARI_04635
   00380 Tryptophan metabolism
    SARI_04635
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SARI_04635
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SARI_04635
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SARI_04635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ses04147]
    SARI_04635
Enzymes [BR:ses01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SARI_04635
Exosome [BR:ses04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SARI_04635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABX24405
UniProt: A9MRK7
Position
4534831..4536039
Genome map
AA seq 402 aa AA seqDB search
MAVSFCAEVGMKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIDRTGVDVNAIDE
VILGQVLTAGAGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIV
IAGGQENMSRAPHVLNDSRTGALPNADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGI
SRELQDAYALSSQQKARAAIDTGRFKDEIVPVVTQRNGQTVIVDTDEQPRADASAEGLAL
LHPAFDSLGSVTAGNASSINDGAAAVMMMSESKAQALGLPVLARIRAFASVGVDPALMGI
APVYATRRCLERAGWQLADVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPI
GASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtctttttgtgctgaggtgggaatgaaagaggttgtgatagtgggggcctta
cggacacctatcggctgttttcaaggaacgctggcccgtcattccgccgtcgaactgggg
agtatggtagtcaaagcgttaattgatcgcacaggcgtggatgttaatgctatcgacgag
gtcatcctcggtcaggtgctgacggctggcgccgggcagaatccggcacgccagtcagcc
atcaaaggagggctgcctaataccgtatccgctattaccattaatgacgtttgtggttcc
ggtttaaaagcattgcacctggcgacccaggcgattcagtgcggtgaggcggacattgtt
atcgcgggcgggcaggagaatatgagccgtgcgccgcatgtcctaaatgacagccgcact
ggcgcgttgcctaatgccgacaatctggtggatagcctggtgcatgatggcttatgggat
gctttcaacgattatcacattggcgtgacggcagaaaacctggcgcgggaatatggcatc
agccgtgaattacaggatgcctatgcgctcagctcgcagcaaaaggccagggctgcgatc
gataccggacgttttaaagatgagattgtccccgtcgtcacgcaacgtaacgggcagaca
gtgattgtcgatactgatgaacaaccgcgggccgacgccagcgcggaggggttagccctg
ctgcatccggcgtttgatagtttaggttcggtgacggcgggtaatgcctcctcaatcaac
gatggcgccgccgccgtgatgatgatgagcgagtcgaaagcccaggctctggggttgcca
gtgctggcgcgcatccgcgcgtttgccagcgtcggagtcgatcctgcgctgatggggatt
gcgccagtatatgccacccggcgttgtctggagcgtgcaggctggcagttggcggatgtc
gatcttatcgaagctaacgaagcgtttgccgcccaggcgttgtcggtaggaaaaatgctg
gaatgggatgagcggcgggtaaacgttaacggaggcgcgattgcgctggggcatcccatt
ggcgcttccggctgtcgaattctggtctcactggtgcatgaaatggttaaacgcgacgcg
cgaaaaggcctggcgacgctttgtataggcggcggtcagggagttgctttaaccattgaa
cgcgactga

DBGET integrated database retrieval system