KEGG   Saccharothrix espanaensis: BN6_07050Help
Entry
BN6_07050         CDS       T02404                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00900  Terpenoid backbone biosynthesis
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01130  Biosynthesis of antibiotics
Module
sesp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN6_07050 (ispE)
Enzymes [BR:sesp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BN6_07050 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CCH28033
UniProt: K0JV08
Position
711024..711989
Genome map
AA seq 321 aa AA seqDB search
MLAVVPPPVTVRVPAKVNLHLAVGDPRADGYHDLVTIFQALSLTDEVTVSVADDPGVEVH
GEGADVVPTGPSNLAWRAARVLAEHVGRDPDHPKVRVSIRKAIPVAGGMAGGSADAAATL
VGLASLWRLEIGRDELAGLAAKIGADVPFALYGGTALGTDRGDQIVPVLARHQFHWVLAF
DRRGLSTPEVFGELDRLRADGDPPRVGAAEAVLEGLASGDPRQLALLLGNDLQAAAVSLR
PNLRRTLRAGVDAGALAGMVSGSGPTCAFLCTDADSAVRVAAELAGAGVCRTVRVAQGPV
HGARVIGTEETPRPTPPEVHA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgtagtcccacccccggtcaccgtccgcgtcccggccaaggtcaacctgcac
ctggcggtcggtgacccgcgcgcggacggctaccacgacctggtgacgatcttccaagcg
ctgtccctgaccgacgaggtgacggtctcggtcgccgacgaccccggcgtcgaggtgcac
ggcgagggtgcggacgtggtgcccaccggaccgtcgaacctggcctggcgggcggcgcgg
gtgctggccgagcacgtcggccgcgaccccgaccaccccaaggtccgggtgtcgatccgc
aaggccatcccggtcgcgggcggcatggcgggcggcagcgcggacgcggcggcgaccctg
gtcggcctggcctcgctgtggcggctggagatcggccgggacgagctggcggggctggcc
gccaagatcggcgcggacgtcccgttcgcgctctacggcggcaccgcgctgggcaccgac
cggggcgaccagatcgtgcccgtgctggcccgccaccagttccactgggtgctcgcgttc
gaccggcgcggcctgtccacgcccgaggtgttcggcgagctcgaccggctgcgcgccgac
ggcgacccgccccgggtcggtgcggccgaggccgtgctggaagggctcgcgtcgggcgac
ccccggcagctcgccctgctgctgggcaacgacctccaggccgccgcggtgtcgctgcgg
ccgaacctgcgccgcaccctgcgcgccggggtggacgccggtgcgctggccgggatggtg
tccgggtccggtcccacctgcgcgttcctctgcaccgacgccgactcggcggtccgggtg
gccgccgagctggccggcgcgggggtgtgccgcacggtgcgcgtcgcgcaggggcccgtc
cacggggcgcgggtgatcgggaccgaggagacgcctcggccgacaccgcccgaagtccac
gcttga

DBGET integrated database retrieval system