KEGG   Saccharothrix espanaensis: BN6_28210Help
Entry
BN6_28210         CDS       T02404                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00071  Fatty acid degradation
sesp00280  Valine, leucine and isoleucine degradation
sesp00281  Geraniol degradation
sesp00310  Lysine degradation
sesp00360  Phenylalanine metabolism
sesp00362  Benzoate degradation
sesp00380  Tryptophan metabolism
sesp00410  beta-Alanine metabolism
sesp00627  Aminobenzoate degradation
sesp00640  Propanoate metabolism
sesp00650  Butanoate metabolism
sesp00903  Limonene and pinene degradation
sesp00930  Caprolactam degradation
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01120  Microbial metabolism in diverse environments
sesp01130  Biosynthesis of antibiotics
sesp01212  Fatty acid metabolism
Module
sesp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN6_28210
   00650 Butanoate metabolism
    BN6_28210
  Lipid metabolism
   00071 Fatty acid degradation
    BN6_28210
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN6_28210
   00310 Lysine degradation
    BN6_28210
   00360 Phenylalanine metabolism
    BN6_28210
   00380 Tryptophan metabolism
    BN6_28210
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN6_28210
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN6_28210
   00281 Geraniol degradation
    BN6_28210
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN6_28210
   00627 Aminobenzoate degradation
    BN6_28210
   00930 Caprolactam degradation
    BN6_28210
Enzymes [BR:sesp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN6_28210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: CCH30132
UniProt: K0JXU8
Position
complement(2992034..2993041)
Genome map
AA seq 335 aa AA seqDB search
MAFVGEVDIRVERGVGRITLNRPEAINALTHDMVRAVDAALVAWAADDGVRSVLLDGAGD
RGLCAGGDIRAVHRDAVAGGTATPGFWADEYRLNARIARFPKPYTALMDGLVMGGGVGVS
AHGSVRVVTERTRLAMPEVGIGLAPDVGGTYLLSRAPGESGTYAALTGGVLSGADAVHCG
LADFLVPSGRLDALREGADVTAPAVEVGPSRLAANRTWIDACFAADTVEEILDRLVAHGE
DATAKEIAAKSPTALKVTLAALRRARALPDLEAVLEQEYRVSVACLRDHDLVEGIRAQII
DKDRSPRWSPATLSGVDDDAVAAHFAEPEVPFRLT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttcgtgggcgaagtggacatccgggtcgagcgcggcgtcggccgcatcacgttg
aaccggcccgaggcgatcaacgccctgacccacgacatggtgcgggcggtcgacgcggcg
ctggtggcgtgggcggcggacgacggcgtgcgctcggtgctgctcgacggggccggggac
cgggggctgtgcgcgggcggcgacatccgcgccgtgcaccgggacgcggtcgccggcggg
acggccacgcccgggttctgggccgacgagtaccggctgaacgcccggatcgcgcggttc
cccaagccgtacaccgcgctgatggacggcctggtgatgggcggcggggtcggggtgtcg
gcgcacgggtcggtgcgggtggtcaccgagcggacccggctggcgatgccggaggtcggc
atcggtctcgcgcccgacgtcggcggcacctacctgctgtcccgcgcgcccggcgagtcg
ggcacctacgcggcgctgaccggcggcgtgctgtccggtgcggacgccgtccactgcgga
ctcgcggacttcctggtgccgtccgggcggttggacgcgctgcgcgagggggccgacgtc
acggcgccggccgtcgaggtcgggccgtcccggctggccgccaaccggacgtggatcgac
gcgtgcttcgccgccgacaccgtggaggagatcctcgaccggctggtggcgcacggcgag
gacgcgacggccaaggagatcgcggcgaagtcgcccacggcgctgaaggtgacgctggcc
gcgttgcgccgggcccgcgccctgccggacctggaagccgtgctggagcaggagtaccgg
gtgtcggtggcgtgcctgcgcgaccacgacctggtcgagggcatccgcgcgcagatcatc
gacaaggaccggtcgccccggtggtcgcccgcgaccctgtccggagtggacgacgacgcc
gtggccgcgcacttcgccgaacccgaagtcccgttccgcctgacctga

DBGET integrated database retrieval system