KEGG   Saccharothrix espanaensis: BN6_39910Help
Entry
BN6_39910         CDS       T02404                                 

Definition
(GenBank) hypothetical protein
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00340  Histidine metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BN6_39910
Enzymes [BR:sesp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     BN6_39910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCH31278
UniProt: K0K3Z9
Position
complement(4371182..4373164)
Genome map
AA seq 660 aa AA seqDB search
MSRHISEERHPGPRSATTDATWPDPPIPVEPVDHGPARTTPVPAKPVPDKPPWDTSAVGA
PRAQTSTPTAPAPRNPDPAAGGTRPADGEPDDAEFEIPAAGLTSQQRKRALNTLETYLVG
KHEHMVGFQGNQDMGHAQQDLARFLDFHLNNVGDPFQQGNYKPNTKVVERAVLDRYASLW
RAECPYDAENPDSYWGYVLTMGSTEGNLYALASARDYLSGRKLIGAPDGGSDPSTSQMVY
VQAAPPARLVPAARDGDSPTADPRNAYRPVAFYSEDTHYSVIKAVRTLAIDTFGAIGTTE
YPGQCPIADRWPMEVPSKGGADGSGEIDVDKLEALVRFFAERGHPVLLLLNFGTTFKGAY
DNVEKVAARLIPILRQHGLLEREIEFEPGRTDRRRGFWVHVDGALGAGIMPFLRQAAEED
PTSELAIALHRELKGKVPEFDFGLRVDGVDVVGSLVMSGHKWAGAPFPCGVFMTKNKFRV
EPAATPAYTGSPDTTFAGSRNGLSPLVLWNHLASKSTREHAAAAVRALRTTRYLESSLRE
LEDRLDREDRLPEGGLYVDRSPMALTVRFRRPHDRLIEKWSLSCQPMNTNAGEPRHYAHV
FVMPSVTEDKVDLLMEDLFTEGAFDRPTPVHHPRPTTAATAFATDVHPLALVPTTGRGFQ
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcacatcagcgaggaacggcaccctggcccgcgcagcgcgaccacggacgcg
acgtggcctgatccgccgatccccgtcgaacccgtcgaccacgggccggcgcgcaccaca
ccagtaccggcgaagcccgttccggacaaaccgccatgggacacctctgcggtgggcgca
ccgcgagcgcagacttcgacgcccaccgccccggctccccgcaaccccgaccccgccgcc
ggaggaacccgcccggcggacggcgagcccgacgacgcggagttcgagatccccgccgca
gggctgacctcgcagcagcgcaagcgcgcgctcaacacgctggagacgtacctggtcggc
aagcacgagcacatggtgggcttccaaggcaaccaggacatggggcacgcgcagcaggac
ctcgcccggttcctcgacttccacctcaacaacgtcggcgacccgttccagcagggcaac
tacaaacccaacacgaaggtcgtggaacgcgcggtgctggaccgctacgcctcgctgtgg
cgggcggagtgcccttacgacgccgagaaccccgacagctactggggttacgtgctgacg
atggggtcgaccgagggcaacctgtacgcgctggcctccgcgcgtgactacctgtcgggg
cgcaagctgatcggcgcgcccgacggcgggtccgacccgtcgacgtcgcagatggtgtac
gtgcaggccgcgccgcccgcgcggctggtgccggcggcccgggacggcgactcgccgacg
gccgacccgcgcaacgcctaccggccggtggcgttctactccgaggacacccactactcg
gtgatcaaggccgtgcggacgctggcgatcgacacgttcggcgcgatcggcaccaccgag
tacccgggccagtgcccgatcgccgaccggtggccgatggaggtgccgtccaagggcggc
gcggacggcagcggcgagatcgacgtcgacaagctggaggcgctggtccggttcttcgcc
gagcgcggccacccggtcctgctgctgctcaacttcggcaccacgttcaagggcgcgtac
gacaacgtcgagaaggtcgccgcccgactgatcccgatcctgcggcagcacggcctgctg
gagcgcgagatcgagttcgagccggggcgcaccgaccgccggcgcggcttctgggtgcac
gtggacggggcgctgggtgccgggatcatgccgttcctgcggcaggcggccgaggaggac
cccaccagcgaactggccatcgcgttgcaccgggagctgaagggcaaggtccccgagttc
gacttcgggctgcgagtcgacggcgtggacgtggtcggctcgttggtgatgagcggccac
aagtgggccggcgcgccgttcccgtgcggcgtgttcatgacgaagaacaagttccgcgtg
gagccggcggcgacacccgcgtacacgggctcgccggacaccacgttcgccggatcgcgc
aacggcctgtcgccgttggtgctgtggaaccacttggcgtccaagtccacccgggaacac
gcggcggccgccgtgcgggcgttgcgcacgacccggtacctggaaagctccctgcgcgaa
ctggaagaccgcctggaccgcgaagaccgcctacccgaaggcggcctgtacgtggaccgc
agcccgatggccctgacggtccgcttccgccgaccgcacgaccggctcatcgagaagtgg
tccctgtcgtgccagccgatgaacaccaacgcgggcgaaccacgccactacgcccacgtg
ttcgtgatgccgtcggtgacggaggacaaggtcgacctgctcatggaagacctcttcacc
gaaggagccttcgaccgcccgacccccgtccaccacccacgcccgacgaccgccgcgacc
gcgttcgccaccgacgtccacccactggccctggtgccgaccaccggccgcggcttccag
tga

DBGET integrated database retrieval system