KEGG   Saccharothrix espanaensis: BN6_68660Help
Entry
BN6_68660         CDS       T02404                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sesp  Saccharothrix espanaensis
Brite
KEGG Orthology (KO) [BR:sesp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN6_68660
Enzymes [BR:sesp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BN6_68660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: CCH34103
UniProt: K0KBY5
Position
7620674..7621447
Genome map
AA seq 257 aa AA seqDB search
MRVALCQITSSADPAANLDLLRGQVARAEGARVVLFPEAAMCRFGVPLGPVAEPLDGPWA
TAVREIADEHGVVVVAGMFTPAPDGRVANTLLVTGGGLHVGYDKIHLFDAFGFTESKTVA
PGAEPVVVEVDGVTFGLATCYDVRFPELFRALADRGAAAVLLGASWGAGPGKREQWELLV
RARALDSTSWVLACGQADPAVDHGGAPTGIGYSAVASPLGEVVGSLGAEPGVLFAEVDQA
TVDQARRALPVLANRRL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcgcgctctgccagatcacctcctccgccgacccggcggccaacctcgacctg
ctgcgcggccaggtggcccgcgccgagggggcccgggtcgtgctgttcccggaagccgcg
atgtgcaggttcggcgtgccgctcggaccggtcgccgagccgctggacgggccgtgggcg
acggccgtgcgggagatcgccgacgagcacggcgtcgtggtcgtggccggcatgttcacg
cccgcgccggacggccgggtcgccaacaccctgctggtcaccggcggcgggctgcacgtg
ggctacgacaagatccacctgttcgacgcgttcgggttcaccgagtcgaagaccgtcgcg
ccgggcgcggagccggtggtggtcgaggtcgacggcgtcaccttcggcctggccacctgc
tacgacgtgcgcttccccgagctgttccgggcgctggccgaccgcggcgcggcggccgtg
ctgctgggggcgtcgtggggcgccgggccgggcaagcgggagcagtgggagctgctggtg
cgggcgagggcgctggacagcacgtcgtgggtgctggcgtgcgggcaggccgacccggcg
gtcgaccacggcggcgcgccgaccgggatcgggtacagcgcggtcgcgtcgccgctgggc
gaggtcgtgggttcgctgggcgcggagccgggcgtgctgttcgccgaggtcgaccaggcc
accgtcgaccaggcccgccgcgcactacccgtcctcgccaaccggcggctctga

DBGET integrated database retrieval system