KEGG   Saccharothrix espanaensis: BN6_83800Help
Entry
BN6_83800         CDS       T02404                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sesp  Saccharothrix espanaensis
Pathway
sesp00010  Glycolysis / Gluconeogenesis
sesp00020  Citrate cycle (TCA cycle)
sesp00620  Pyruvate metabolism
sesp01100  Metabolic pathways
sesp01110  Biosynthesis of secondary metabolites
sesp01120  Microbial metabolism in diverse environments
sesp01130  Biosynthesis of antibiotics
sesp01200  Carbon metabolism
Module
sesp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sesp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN6_83800
   00020 Citrate cycle (TCA cycle)
    BN6_83800
   00620 Pyruvate metabolism
    BN6_83800
Enzymes [BR:sesp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN6_83800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: CCH35596
UniProt: K0KBQ7
Position
complement(9181476..9182963)
Genome map
AA seq 495 aa AA seqDB search
MPQFKRFPLPDTAEGLTEAEILTWHVGPGDTVKVNDIIVEIETAKAAVELPCPWDGVVTE
LLVEVGQTVEVGVPIITIDVDPSGTAAPAAPAAPETNGVAATPAEGEGRVANLVGYGPKS
GPAKRRARRDAPAPAASSVAVAPPPPPAPTPVATPAPAPTPVATPVATPVATPVAAPTPV
AVAAPAPVAQPGGYVPLAKPPVRKLAKDLGVDLQVLAGSGPGGVITREDVEQALTAPAPT
TSAAASTLASTVASTVDNGYAAGSRERRVPIKGVRKATAQAMVDSAFTAPHVTEFLTIDV
TPMMELRARLKGTAEFRDVKLTPLAFAAKAVVLATRRTPDVNATWDAAAGEIVYKDYVHL
GIAAATPRGLVVPKVRDADRMSLRELAIALDGLATVARDGKTSPADMMNGTITITNVGVF
GVDTGTPIINPGESAILAFGAIRDMPWVVDGQVVPRKVCQLALSFDHRVVDGQQGSQFLA
DVGALLADPGIALTY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagttcaagcgattccccctgccggacacggcggaagggctgaccgaggccgag
atcctgacctggcacgtgggtccgggcgacacggtcaaggtcaacgacatcatcgtggag
atcgagaccgccaaggcggcggtcgagctgccgtgcccgtgggacggcgtggtgaccgag
ctgctggtggaggtgggccagacggtcgaggtcggcgtcccgatcatcaccatcgacgtg
gacccgtccggcaccgccgcgcccgccgcgcccgccgcgccggagaccaacggcgtggcc
gcgacccccgccgagggcgagggccgggtggccaacctggtcgggtacgggccgaagtcc
gggccggccaagcgccgcgcccgccgggacgcccccgcgccggcggcctcgtcggtcgcg
gtcgccccgccgccgccccccgcaccgactccggtcgcgactccggctccggccccgact
ccggtcgcgactccggtcgcgactccggtcgcgactccggtcgcggccccgactccggtg
gcggtcgcggctccggccccggtcgcgcagccgggcgggtacgtcccgctggccaagccg
ccggtccgcaagctcgccaaggacctgggcgtggacctccaggtgctggccggcagcggc
cccggtggcgtgatcacccgcgaggacgtggagcaggcgctcaccgcaccggcacccacg
acatccgctgcggcgtccactctggcgtccactgtggcgtccactgtggacaatggctac
gccgcaggctcgcgggaacgccgggtgccgatcaagggcgtccgcaaggcgaccgcgcag
gcgatggtcgacagcgcgttcaccgcgccgcacgtcaccgagttcctgaccatcgacgtg
acgccgatgatggagctgcgcgcccggctcaagggcacggccgagttccgcgacgtcaag
ctcaccccgctggcgttcgcggccaaggccgtggtgctggcgacccgccgcacgcccgac
gtgaacgcgacgtgggacgcggcggccggcgagatcgtctacaaggactacgtgcacctg
ggcatcgcggccgccacgccgcgcggcctggtcgtgcccaaggtccgggacgcggaccgg
atgtcgttgcgggaactggcgatcgcgctggacgggctggcgacggtggcccgggacggc
aagacgtcaccggcggacatgatgaacgggaccatcaccatcaccaacgtcggcgtgttc
ggcgtcgacaccggcaccccgatcatcaaccccggcgagtccgcgatcctcgcgttcggc
gcgatccgcgacatgccgtgggtggtcgacggccaggtcgtgccgcgcaaggtctgccaa
ctggccctcagcttcgaccaccgcgtggtcgacggccagcagggctcgcagttcctcgcc
gacgtgggcgccctgctcgccgacccgggcatcgccctgacctactga

DBGET integrated database retrieval system