KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN0011Help
Entry
SEN0011           CDS       T00776                                 

Gene name
dnaK
Definition
(GenBank) DnaK protein (heat shock protein 70)
  KO
K04043  molecular chaperone DnaK
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:set00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SEN0011 (dnaK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:set03019]
    SEN0011 (dnaK)
   03110 Chaperones and folding catalysts [BR:set03110]
    SEN0011 (dnaK)
   03029 Mitochondrial biogenesis [BR:set03029]
    SEN0011 (dnaK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:set04147]
    SEN0011 (dnaK)
Messenger RNA biogenesis [BR:set03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     SEN0011 (dnaK)
Chaperones and folding catalysts [BR:set03110]
 Heat shock proteins
  HSP70 / DNAK
   SEN0011 (dnaK)
Mitochondrial biogenesis [BR:set03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    SEN0011 (dnaK)
  Matrix
   MMC/PAM proteins
    SEN0011 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SEN0011 (dnaK)
Exosome [BR:set04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SEN0011 (dnaK)
  Exosomal proteins of breast cancer cells
   SEN0011 (dnaK)
  Exosomal proteins of colorectal cancer cells
   SEN0011 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C RNA_pol_Rpb1_6
Motif
Other DBs
NCBI-ProteinID: CAR31602
UniProt: B5R5I2
Position
11358..13274
Genome map
AA seq 638 aa AA seqDB search
MGKIIGIDLGTTNSCVAIMDGTQARVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVT
NPQNTLFAIKRLIGRRFQDEEVQRDVSIMPYKIIGADNGDAWLDVKGQKMAPPQISAEVL
KKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYG
LDKEVGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDTRLINYL
VDEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKV
TRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDINDVILVGGQTRMPMVQKKVAEFFGKE
PRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTPLITKNTTIPT
KHSQVFSTAEDNQSAVTIHVLQGERKRASDNKSLGQFNLDGINPAPRGMPQIEVTFDIDA
DGILHVSAKDKNSGKEQKITIKASSGLNEEEIQKMVRDAEANAESDRKFEELVQTRNQGD
HLLHSTRKQVEEAGDKLPVDDKTAIESALNALETALKGEDKAAIEAKMQELAQVSQKLME
IAQQQHAQQQAGSADASANNAKDDDVVDAEFEEVKDKK
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaattattggtatcgacctgggtactaccaactcttgtgtagcgattatggat
ggaacgcaggcacgcgtgctggagaacgccgagggcgatcgcactacgccttctatcatt
gcttatacccaggatggtgaaactctggttggtcagccggctaaacgtcaggcagtgaca
aacccgcaaaacaccctgtttgcgattaaacgcctgattggccgccgcttccaggacgaa
gaagttcaacgtgacgtttctatcatgccgtacaaaatcatcggcgccgacaacggcgac
gcatggcttgatgtgaaaggtcagaaaatggcgccgccgcagatttctgccgaagtgctg
aagaaaatgaagaaaacggctgaagattatctgggcgaaccggtaactgaagcggttatc
accgtaccggcttactttaacgatgcgcagcgtcaggctaccaaagatgctggtcgtatc
gcggggctggaagttaaacgtatcatcaacgaaccgactgccgcagcgctggcttacggt
ctggataaagaagtcggcaaccgtactatcgcggtttacgacctcggtggtggtactttc
gatatctctattatcgaaatcgacgaagttgatggcgaaaaaacctttgaagttctggca
accaacggtgatacccacttgggtggtgaagacttcgatacccgcctgatcaactacctc
gttgacgagtttaagaaagatcagggcattgacctgcgtaacgatccgctggccatgcag
cgcctgaaagaagccgcagaaaaagccaaaatcgagctgtcttctgcgcagcagaccgac
gtgaacctgccgtacattaccgcagatgccaccggtccgaaacacatgaacatcaaagtg
actcgtgcaaaactggaaagcctggttgaagatctggtgaaccgttctatcgagccgctg
aaagtcgcactgcaggacgctggcctgtccgtgtctgatatcaacgacgtgatcctcgtc
ggcggtcagacccgtatgccaatggtgcagaaaaaagtggctgaattctttggtaaagag
ccgcgtaaagacgttaacccggacgaagctgtggctatcggcgcagcggtacagggcggc
gtgttgaccggtgatgtgaaagacgtactgctgctggacgttaccccgctgtctctgggt
atcgaaacgatgggtggcgtgatgactccgcttatcaccaaaaacaccaccatcccgacc
aagcacagccaggtgttctctactgcggaagacaaccagtctgcggtaaccatccatgtg
ctgcagggtgagcgtaaacgtgcgtctgataacaaatctctgggtcagttcaacctggat
ggcatcaacccggcgccgcgcggtatgccgcagatcgaagtcaccttcgatatcgatgct
gacggtatcctgcacgtctccgcgaaagataaaaatagcggtaaagagcagaagatcact
atcaaggcgtcttctggtctgaacgaggaagaaattcagaaaatggttcgcgatgcagaa
gcgaacgctgaatccgaccgtaagttcgaagagctggttcagacccgtaaccagggcgac
catctgctgcacagcacccgtaagcaggttgaagaagcaggcgataaactgccggttgat
gacaaaaccgctatcgagtctgcgctgaacgcgctggaaactgccctgaaaggcgaagat
aaagccgctatcgaagcgaaaatgcaggaactggcgcaggtttcccagaaactgatggaa
atcgctcagcagcaacatgcgcagcagcaggctggctccgctgacgcttctgcaaacaac
gcgaaagatgacgacgttgtcgacgctgagtttgaagaagtaaaagataaaaaataa

DBGET integrated database retrieval system