KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN0056Help
Entry
SEN0056           CDS       T00776                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha chain (ec 4.1.1.3)
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00620  Pyruvate metabolism
set01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:set00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEN0056
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:set02000]
    SEN0056
Enzymes [BR:set01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     SEN0056
Transporters [BR:set02000]
 Other transporters
  Primary active transporters [TC:3]
   SEN0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: CAR31646
Position
complement(64617..66386)
Genome map
AA seq 589 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PMAAFELVSEIKKRYDVRLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTEHDTGLDILKLENIAAYFREVRKKYHAFEGQLKGYDSRILVAQVPGGML
TNLESQLKQQNAADKLDQVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGGAPVTCRPADLLKPELAELEADVRRQAQEK
GIQLAGNAIDDVLTVALFPQIGLKFLENRHNPAAFEPLPQAEAAQPVTKAEKPAASGIYT
VEVEGKAFVVKVSDGGDISQLTAAAPAASSAPATAPAGAGTPVTAPLAGNIWKVIATEGQ
TVAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVSVGDTLMTLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgccattaccgacgtcgtcctgcgtgacgcccaccagtctctgttcgccacc
cgcctgcgccttgatgacatgctgccgattgccgccgcgctcgatgacgtgggctacggg
tcgctggagtgctggggcggcgccacctttgacgcctgtatccgctttctcggcgaagac
ccgtggctgcgcctgcgcgaactgaaaaaagccatgcccaaaaccccactgcagatgctg
ctgcgcggccagaacctgctcggttatcgccattacgccgatgacgtggtggaacgcttc
gtcgaacgcgccgtcaaaaacggcatggacgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaagccgccctgcaggcggtacgtagccacggggcgcacgcccagggc
acgctctcctacaccaccagtccggcgcacaccctgcagacctggctggatttaacagag
caactgctggaaaccggcgttgactcgattgccatcaaggatatgtccggcattctcacc
ccgatggccgcttttgagctggtgagcgaaatcaaaaaacgctacgacgtacgtctgcac
ctgcactgtcacgccaccaccgggatggcggagatggccctgctgaaggctatcgaggcg
ggtgttgacggcgtggacacggcgatttcgtccatgagcgccacctacggccacccggcc
accgaagcgctggtggcgacgttggcaggtactgagcatgacaccgggctggatatcctg
aagctggaaaatatcgccgcgtacttccgcgaggtgcgcaaaaagtaccacgcctttgaa
ggccagctgaaaggctacgacagccgcatcctggtggcgcaggtgccgggcggaatgctc
actaacctcgaaagccagctgaagcagcagaacgcggcggacaaactcgaccaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggctttattccgctggtgacccccacctca
cagattgtcggcacccaggcggtgctcaacgtgctgacgggcgaacgctacaagaccatt
gccaaagaaacggcgggcattctgaaaggcgaatacggccacaccccggtgccggtgaac
gccgcgttacaggcccgcgtgctggaaggaggcgctccggtgacctgccgcccggcagac
ctgctgaagccggaactggctgaactggaagcggacgtcaggcgccaggcgcaggagaag
gggattcagcttgcgggaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
atcggcctcaaattcctcgaaaaccgccacaacccggcggcgtttgagccactgccgcag
gcggaagccgcgcagccggtgacaaaagcagagaagcctgccgcttccggtatctacacc
gtggaagtggaaggcaaagcctttgtggtgaaggtcagcgacggcggcgatatcagccag
ctcactgcggctgcacctgctgcctcttctgctcctgccaccgccccggcaggcgccggc
accccggtcaccgcgccgctggcgggcaacatctggaaggtgattgccaccgaaggccag
acagtggccgaaggcgatgtgctgctgattctggaagccatgaagatggaaaccgaaatc
cgcgccgcgcaggccgggacggtacgcggtatcgcggtgaagtccggggacgcggtttcc
gtgggcgacaccctgatgacgctggcgtaa

DBGET integrated database retrieval system