KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN0934
Entry
SEN0934           CDS       T00776                                 

Gene name
ycbG
Definition
(GenBank) conserved hypothetical protein
  KO
K09911  uncharacterized protein
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Brite
KEGG Orthology (KO) [BR:set00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SEN0934 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: CAR32517
UniProt: B5QZF9
Position
1038293..1038745
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYVEASAAQEAVNLLLALENEPVRVNVWIDR
HMNPALLNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAQRRGKTLSETIV
QLIEDAEHKEKYATQMTTLKQDLQALLGKK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaaatatctggtgaaa
aagcaccgcgaaggggagttgatcacccgctacgtggaagccagtgctgcccaggaagcc
gtcaatttgttgttggccctcgaaaatgaaccggtgcgggtaaatgtctggatagacagg
catatgaatcctgccttgcttaatcggatgaaacaaaccattcgggcaagacgcaaacga
cacttcaatgcggaacatcagcatacgcgcaaaaaatctatcgatttagagtttatggtc
tggcagcgtctggcgggccttgcgcagcgacgcggtaaaacattatccgaaacgatagtg
caactgatagaagacgcggagcataaagagaaatatgccacgcaaatgaccacgttaaag
caggatttacaggcgttattaggcaagaagtaa

DBGET integrated database retrieval system