KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN1913Help
Entry
SEN1913           CDS       T00776                                 

Gene name
ycdW
Definition
(GenBank) putative 2-hydroxyacid dehydrogenase in phoh-csgg intergenic region
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00260  Glycine, serine and threonine metabolism
set00620  Pyruvate metabolism
set00630  Glyoxylate and dicarboxylate metabolism
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:set00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEN1913 (ycdW)
   00630 Glyoxylate and dicarboxylate metabolism
    SEN1913 (ycdW)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SEN1913 (ycdW)
Enzymes [BR:set01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     SEN1913 (ycdW)
    1.1.1.81  hydroxypyruvate reductase
     SEN1913 (ycdW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CAR33493
UniProt: B5QY30
Structure
PDB: 

Position
complement(2012686..2013624)
Genome map
AA seq 312 aa AA seqDB search
MEIIFYHPTFNTAWWVNALEKALPHARVREWKVGDNNPADYALVWQPPVEMLAGRRLKAV
FALGAGVDAILSKLNAHPEMLDASIPLFRLEDTGMGLQMQEYAVSQVLHWFRRFDDYQAL
KNQALWKPLPEYTREEFSVGIMGAGVLGAKVAESLQAWGFPLRCWSRSRKSWPGVESYVG
REELHAFLNQTRVLINLLPNTAQTVGIINSELLDQLPDGAYVLNLARGVHVQEADLLAAL
DSGKLKGAMLDVFSQEPLPQESPLWRHPRVAMTPHIAAVTRPAEAIDYISRTITQLEKGE
PVTGQVDRARGY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagataattttttatcacccgacatttaacaccgcctggtgggtaaatgcgctggag
aaggctctcccacatgcgcgcgttcgtgaatggaaggtcggtgataacaaccccgcagac
tatgcgcttgtatggcagcccccggttgaaatgctggccggaagacgcttaaaagccgtc
tttgcgctgggcgcgggggtggatgcaattctgagtaaattaaatgcgcatccggaaatg
ctggacgcctccattcctctattccgtctggaagataccggaatgggcctgcaaatgcag
gaatatgccgtaagtcaggtattacactggttccgtcgtttcgatgattatcaggcgctg
aaaaatcaggcgctatggaaaccgttgccggaatatacccgcgaagagtttagcgtcggt
atcatgggcgcaggggtactgggcgcaaaagtggcagaaagtctacaggcgtgggggttc
ccgttacgttgctggagtcgtagccgcaaatcctggcctggcgtggaaagttatgttggg
cgtgaagagctgcacgctttcctgaaccagacgcgggtgctgattaatctgctgccgaat
acggcccaaacggtaggaattattaatagcgaattgttggatcaattgccggatggcgct
tacgtgttgaatctcgcgcgcggcgtgcatgttcaggaggcggatctgctggctgcgctt
gatagcggtaagctaaaaggcgcgatgttggatgtctttagccaggaaccgttaccgcag
gaaagtccattatggcgccatccgcgagtcgccatgacgccgcacattgcggcagtcacc
cgtccagcggaagccatcgattatattagccgcaccattacccagctggagaagggagag
ccggtgacggggcaggtggatcgggcgagaggatattga

DBGET integrated database retrieval system