KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN2862Help
Entry
SEN2862           CDS       T00776                                 

Gene name
yqeF
Definition
(GenBank) probable acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00071  Fatty acid degradation
set00280  Valine, leucine and isoleucine degradation
set00310  Lysine degradation
set00362  Benzoate degradation
set00380  Tryptophan metabolism
set00620  Pyruvate metabolism
set00630  Glyoxylate and dicarboxylate metabolism
set00640  Propanoate metabolism
set00650  Butanoate metabolism
set00900  Terpenoid backbone biosynthesis
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
set01130  Biosynthesis of antibiotics
set01200  Carbon metabolism
set01212  Fatty acid metabolism
set02020  Two-component system
Brite
KEGG Orthology (KO) [BR:set00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEN2862 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SEN2862 (yqeF)
   00640 Propanoate metabolism
    SEN2862 (yqeF)
   00650 Butanoate metabolism
    SEN2862 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SEN2862 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SEN2862 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEN2862 (yqeF)
   00310 Lysine degradation
    SEN2862 (yqeF)
   00380 Tryptophan metabolism
    SEN2862 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SEN2862 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SEN2862 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SEN2862 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:set04147]
    SEN2862 (yqeF)
Enzymes [BR:set01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SEN2862 (yqeF)
Exosome [BR:set04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SEN2862 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAR34440
Position
complement(3068345..3069523)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttaaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system