KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN3326Help
Entry
SEN3326           CDS       T00776                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00010  Glycolysis / Gluconeogenesis
set00020  Citrate cycle (TCA cycle)
set00620  Pyruvate metabolism
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
set01130  Biosynthesis of antibiotics
set01200  Carbon metabolism
Module
set_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:set00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEN3326 (pckA)
   00020 Citrate cycle (TCA cycle)
    SEN3326 (pckA)
   00620 Pyruvate metabolism
    SEN3326 (pckA)
Enzymes [BR:set01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     SEN3326 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: CAR34901
UniProt: B5R360
Position
3537321..3538940
Genome map
AA seq 539 aa AA seqDB search
MRVNNLTPQDLKAYGINDVQDIVYNPSYDTLYQEELNPGLEGYERGVLTNLGAVAVDTGI
FTGRSPKDKYIVRDDTTRDTLWWSDKGKGKNDNKPLSQETWQHLKGLVTHQLSGKRLFIV
DAFCGANADTRLSVRFITEVAWQAHFVKNMFIRPTDEELVGFKPDFIVMNGAKCTNPQWK
EQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSVMNYLLPLKGIASMHCSANVGEKG
DVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEIY
HAIRRDALLENVTVREDGTVDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFLT
ADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTEPTPTFSACFGAAFLTLHPTQY
AEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFRLPLFDLA
IPTELPGVDTHILDPRNTYASPEQWQEKATALAKLFIENFEKYTDTPAGEALVSAGPKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacaatttaaccccgcaagatctcaaggcttatggtatcaacgacgtccag
gatatcgtttacaatcccagctacgacaccctttatcaggaagaacttaatcctggtctg
gaaggctatgagcgtggcgtgttaactaacctgggcgctgttgccgttgataccggtatt
tttaccggtcgttcgcctaaggataagtatattgttcgcgacgacaccacgcgtgatacg
ctgtggtggtccgataagggtaaaggtaaaaacgataataagccgctttcccaggaaacc
tggcaacacctgaaaggtctggtgacgcatcagctttctggtaaacgcttattcattgtt
gatgcgttctgcggcgcaaatgccgatacgcgtctttccgtgcgctttattacggaagtc
gcctggcaggcccacttcgttaaaaatatgttcattcgcccaacggacgaagagctggta
ggcttcaaacctgactttattgtcatgaacggcgcgaagtgcaccaacccgcagtggaaa
gagcaaggactgaactcggaaaacttcgtggcgttcaacctgactgaacgtattcagctt
attggcggcacctggtacggcggcgaaatgaaaaaagggatgttctcggtaatgaactac
ctgctgccgctcaaaggtatcgcctcaatgcactgttccgccaacgtgggtgaaaaaggc
gatgtcgcggtcttcttcggcctttccggtaccggaaaaaccactctgtccaccgacccg
aaacgtcgtctgattggcgatgatgagcacggttgggatgacgacggcgtgttcaacttt
gaaggcggctgctacgccaaaaccatcaaactgtcgaaagaagcggagccagaaatttat
catgcgattcgccgtgatgcgttgctggaaaacgtcaccgtgcgcgaagacggcaccgtt
gatttcgacgatggttccaaaaccgaaaacacccgcgtctcttacccgatctatcatatc
gataacatcgttaagcccgtatccaaagcaggtcacgccacgaaggttatcttcctgacg
gcggacgccttcggcgtgttgccgccggtttcccgtttaaccgctaaccagacgcagtac
cacttcctgtcaggtttcaccgctaaactggccggcaccgaacgcggcgtcaccgaaccg
acccccaccttctccgcctgcttcggcgccgcgttcctgacgctgcacccgacgcagtat
gctgaagtgctggtgaaacgtatgcaagcagcgggcgcgcaggcttatctggttaacacc
ggctggaatggcaccggcaaacgtatctccatcaaagatacgcgcgcaattatcgacgcc
attctgaacggttctcttgataacgcggaaaccttccgtctgccgctgttcgatctggcg
atcccgactgaactgccaggcgtggatacccacattctcgacccgcgtaacacctacgcg
tcgccggaacaatggcaggaaaaagccaccgcgctggcgaaactgttcattgagaacttc
gagaagtatacggataccccggcaggcgaagcgctggttagcgccggaccgaagctgtaa

DBGET integrated database retrieval system