KEGG   Salmonella enterica subsp. enterica serovar Enteritidis P125109: SEN3966Help
Entry
SEN3966           CDS       T00776                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
set  Salmonella enterica subsp. enterica serovar Enteritidis P125109
Pathway
set00630  Glyoxylate and dicarboxylate metabolism
set01100  Metabolic pathways
set01110  Biosynthesis of secondary metabolites
set01120  Microbial metabolism in diverse environments
set01200  Carbon metabolism
Module
set_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:set00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SEN3966 (aceA)
Enzymes [BR:set01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SEN3966 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAR35535
Position
4275481..4276785
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKIWRLLHGE
AKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDADAADL
ITSDCDPYDSGFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtactcaacaaatcgaagaattacagaaagagtggacacaaccgcgctgg
gaaggcatcacccgcccgtacagcgcggaggaggtggtgaaattacgcggctcggttaac
ccggaatgcacgctggcgcagctcggcgcagcgaaaatttggcggctgttgcacggtgaa
gcgaaaaaaggctatatcaacagccttggcgcgctgactggcggtcaggcgttgcagcag
gcgaaagccggtattgaggcgatttatctttcaggctggcaggtagcggcagatgccaac
ctggcatccagcatgtatccggatcaatcgttgtacccggcaaactctgttccggcggta
gtggatcggatcaacaacacttttcgtcgtgcagatcagatccagtgggcatccggtatt
gaacccaatgatccgcgctatgtggattacttcctgccgatcgttgctgatgcggaagcc
ggttttggcggcgttctgaatgccttcgaactgatgaaatcgatgattgaagccggtgca
gcggccgttcacttcgaagatcagctggcgtcggtgaagaaatgcggccatatgggcggc
aaggtgctggtccccacgcaggaagcgattcagaaactggttgctgcgcgtctggccgct
gatgtgatgggtgtcccgacgctggtgattgcgcgtaccgatgcggatgcggcagatctg
attacttccgactgcgatccctatgacagcggttttattaccggcgaacgcaccagcgaa
ggtttctaccgcacccatgcgggcattgagcaggcgatcagccgcggtctggcgtatgcc
ccgtatgccgatctggtatggtgcgaaacttctacgccggatctcgaattggcgcgtcgt
tttgccgatgctatccacgcgaagtatccgggcaaactgctggcctataactgttcgcca
tccttcaactggcagaagaatctggacgacaagaccattgccagcttccagcagcagttg
tcggacatgggttacaaataccagtttattaccctggcgggcatccacagcatgtggttc
aacatgttcgacctggcgcatgcatacgcgcagggcgagggcatgaagcactatgttgag
aaggttcaacaacccgagttcgccgcggcgaaagacggctacacctttgtttcccaccag
caggaagtgggtacaggttacttcgacaaagtcaccaccattattcagggcggcgcgtca
tccgttaccgcgttaacaggatcgacggaagaatcgcagttttga

DBGET integrated database retrieval system