KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_10455Help
Entry
CFSAN001921_10455 CDS       T02737                                 

Gene name
btuE
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
setc00480  Glutathione metabolism
setc00590  Arachidonic acid metabolism
setc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:setc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CFSAN001921_10455 (btuE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CFSAN001921_10455 (btuE)
Enzymes [BR:setc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CFSAN001921_10455 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin
Motif
Other DBs
NCBI-ProteinID: AGQ68088
Position
complement(2140456..2141007)
Genome map
AA seq 183 aa AA seqDB search
MQNSLLNTHVTTIDGEVTTLEKYAGKVLLIVNVASRCGLTPQYEQLENIQKAWADQGFVV
LGFPCNQFMGQEPGSEEEIKTYCASTWGVTFPMFSKIDVNGDARHPLYQKLIAAAPTAVA
PEKSGFYERMVSKGRTPLYPDDILWNFEKFLVGRDGQVVQRFSPDMTPEDPIVMESIKIA
LAK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaactcgcttcttaatactcacgttacgacgattgatggagaggtcactacactt
gaaaaatacgccggaaaagtgctgctcattgtaaacgtcgcctccagatgtggcctgacg
ccgcaatatgaacagttggaaaatatccaaaaggcgtgggcagatcaggggtttgtcgtg
ttgggttttccctgcaaccagtttatggggcaggagccaggcagcgaagaggagattaaa
acctattgtgccagcacctggggcgtcacgttcccgatgttcagtaaaattgatgtgaat
ggcgacgcgcgccatccgctgtatcaaaaactgatagccgctgcgccaacggcagtcgcg
ccggagaagagcggcttttacgaacggatggtaagcaaagggcgtacgccactctatccg
gatgatattctgtggaattttgaaaaatttttggtaggccgggatggtcaggtggtacag
cgtttttcgccggatatgacgcctgaagatcctattgtgatggaaagcataaaaatcgcg
ttggcaaaataa

DBGET integrated database retrieval system