KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_12525Help
Entry
CFSAN001921_12525 CDS       T02737                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Pathway
setc00260  Glycine, serine and threonine metabolism
setc01100  Metabolic pathways
setc01110  Biosynthesis of secondary metabolites
setc01120  Microbial metabolism in diverse environments
setc01130  Biosynthesis of antibiotics
setc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:setc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFSAN001921_12525
Enzymes [BR:setc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CFSAN001921_12525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AGQ68407
Position
2552155..2553156
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMTAPVGDDVYGDDPTVNALQRYAADLSGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGTLPLENVAAKI
KADDIHFARTRLLSLENTHNGKVLPRAYLKDAWTFTRERGLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRATRWRKMVGGGMRQAGILAAAGLY
ALKHNVARLQEDHDNAAWLAQQLREAGAEVIRHETNMLFVRVGEAQAAALGDYLRERNIL
INAAPIVRLVTHLDVSREQLTDVVAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgggccgcgccatgctcgaggcgatg
atgaccgccccggtcggggacgacgtatacggcgatgaccctactgttaacgcccttcag
cgctacgccgccgacctttccggtaaagaagcggcgctttttttacccaccggcacccag
gccaatctggtcgcgctgcttagccattgtgaacgcggcgaagagtatatcgtcggtcag
ggcgcgcataattatctctatgaagctggcggcgcggcggtgctcggcagcattcagccg
cagcccatcgacgccgccgcggacggtacgctgccgctggagaacgtggcggcgaagatt
aaagcggatgacatccacttcgcgcgcacgcgcttgctcagtctggaaaatacgcataac
gggaaagtgctgccgcgcgcgtatctgaaagacgcctggacatttacccgcgaacgtgga
ctggcgctgcacgttgacggcgcccgaatttttaacgcggtggttgcctacggctgtgag
ttaaaagagattacgcagtattgcgactcttttaccatctgcctgtcaaaaggtctcgga
acgccggtcggttcactgctggtcggcaaccgcgattacattaaacgcgcgacgcgctgg
cgtaaaatggtcggcggcggaatgcgtcaggccgggattctggcagcggccggactgtat
gcgctgaagcataacgtggcgcgtctgcaagaggatcatgataacgccgcctggctggcg
cagcagcttcgggaagcgggcgcggaggtcatacgccacgaaacgaatatgctgtttgtt
cgcgttggcgaagcacaggccgccgcgcttggcgactatttgcgggaacggaatatcctg
attaacgccgcgccgattgtgcgtctggtgacgcatctggatgtctctcgcgaacagctt
accgacgtcgtcgcccactggcgcgcctttttagcccgctaa

DBGET integrated database retrieval system