KEGG   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921: CFSAN001921_16960Help
Entry
CFSAN001921_16960 CDS       T02737                                 

Definition
(GenBank) peptidyl-prolyl cis-trans isomerase
  KO
K03771  peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
Organism
setc  Salmonella enterica subsp. enterica serovar Typhimurium var. 5- CFSAN001921
Brite
KEGG Orthology (KO) [BR:setc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:setc03110]
    CFSAN001921_16960
Enzymes [BR:setc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     CFSAN001921_16960
Chaperones and folding catalysts [BR:setc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    CFSAN001921_16960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase Rotamase_3 SurA_N Rotamase_2 SurA_N_3 SurA_N_2 Trigger_C
Motif
Other DBs
NCBI-ProteinID: AGQ69102
Structure
PDB: 

Position
3461807..3463093
Genome map
AA seq 428 aa AA seqDB search
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAGQAGQQL
PDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIAKQNNMTMDQMRSRLAY
DGLNYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQIGTQNDASTELNLSHIL
IALPENPTSEQVNDAQRQAESIVEEARNGADFGKLAITYSADQQALKGGQMGWGRIQELP
GIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGQSQSISVTEVHARHILLKPSPIMND
QQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWATPDIFDPAFRDALTKL
HKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYRMLMNRKFSEEAATWMQEQRAS
AYVKILSN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactggaaaacgctgcttctcggtatcgccatgatcgcgaataccagtttcgct
gccccccaggtagtcgataaagtcgcagccgtcgtcaataatggcgtcgtgctggaaagc
gacgttgatggcttaatgcaatcagtcaaactcaacgcgggtcaggcaggtcagcagctt
ccggacgacgccacgctgcgtcaccagatcctggaacgtttgattatggatcaaattatc
ctgcagatgggtcagaagatgggggtgaagatcacggatgagcagttggatcaggccatc
gccaacatcgccaaacaaaacaatatgacgatggatcagatgcgcagccgtctggcttac
gatgggctgaactattcaacctaccgtaaccagattcgtaaagagatgattatctctgaa
gtgcgcaacaatgaggttcgtcgccgtatcaccgttttgccgcaagaagttgacgcgctg
gcaaaacagattggcacccaaaacgatgccagcaccgagctgaacctgagccatatcctg
attgctctgccggaaaacccaacctccgagcaggttaacgacgcgcagcgccaggcggaa
agcattgttgaagaagcgcgtaacggcgcagatttcggcaaactggcgattacctactct
gccgaccagcaggcgctaaaaggcggtcagatgggctggggccgtatccaggagctgccg
gggattttcgcccaggcgctgagcaccgcgaagaaaggcgacattgtcggcccgattcgc
tccggcgtcggcttccacattctgaaagtaaatgacctgcgcggtcagagccagagtatc
tccgtgaccgaagttcacgctcgtcacattctgcttaagccgtcgccgatcatgaacgat
cagcaggcgcgcctgaagctggaagaaatcgcggctgacattaagagtggtaaaaccacc
tttgccgctgcggcgaaagagtactctcaggacccgggctccgctaaccagggcggtgat
ttgggttgggctacgccagatattttcgacccggcgttccgcgacgcgctaacgaagctg
cataaaggccaaataagcgcgccggtacactcctctttcggctggcatctgatcgaattg
ctggatacgcgtaaggtagacaaaaccgatgcggcgcagaaagatcgcgcttatcgtatg
ctgatgaaccgtaaattctcagaagaagcggcgacctggatgcaagaacagcgcgccagc
gcttacgttaagattttgagtaactaa

DBGET integrated database retrieval system