KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_07870Help
Entry
STU288_07870      CDS       T02639                                 

Definition
(GenBank) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
setu00520  Amino sugar and nucleotide sugar metabolism
setu01100  Metabolic pathways
setu01503  Cationic antimicrobial peptide (CAMP) resistance
Module
setu_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:setu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STU288_07870
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    STU288_07870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:setu01005]
    STU288_07870
Enzymes [BR:setu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     STU288_07870
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     STU288_07870
Lipopolysaccharide biosynthesis proteins [BR:setu01005]
 Unusual sugar
  STU288_07870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_4 NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AGK09182
Position
1619534..1621516
Genome map
AA seq 660 aa AA seqDB search
MKAVIFAYHDMGCQGVQAVLDAGYEIAAIFTHADNPAENTFFGSVSRQAAELGIPVYAPD
NVNHPIWVDRIAELAPDIIFSFYYRNLLSEEILHLAPAGAFNLHGSLLPAYRGRAPLNWV
LVNGESETGVTLHRMVKRADAGEIVASQRVAIAQDDVALTLHHKLCQAARQLLNSILPTM
KCGDIPSVPQRESDSTYYGRRRPEDGLIDWHKPVSTVHNLVRAVAAPWPGAFSYNGSQKF
TIWSSRMCPDAQGALPGSVISVSPLRVACADGALEIITGQAGDDITVQGSQLAQTLGLVA
GARLNRPPATSGKRRIRVLILGVNGFIGNHLTERLLNEENYEVYGMDIGSNAISRFLLHP
RFHFVEGDISIHSEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYC
VKYRKRVVFPSTSEVYGMCTDASFDEDKSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEK
EGLRFTLFRPFNWMGPRLDSLNAARIGSSRAITQLILNLVEGTPIKLIDGGQQKRCFTDI
RDGIEALFRIIVNDGDRCDGKIINIGNPDNEASIQELATLLLDSFDKHPLRCHFPPFAGF
QVVESRSYYGKGYQDVAHRKPSIDNARRCLGWEPSIAMRDTVEETLDFFLRSVDIAERAS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttatttttgcctatcacgatatgggatgtcagggggtgcaggccgtactg
gatgccgggtatgagattgccgcgattttcactcatgccgacaatcctgcggaaaacacc
ttttttggctccgtctcccggcaggcggcagaattagggattccggtttatgcaccggat
aacgtaaaccatcctatctgggtcgaccgcatcgctgagcttgcgccggatattattttt
tcgttctattaccgcaacctgttaagcgaagaaattctgcacctcgccccggctggcgcg
ttcaatctgcacggttctctattgcctgcctatcgtggccgtgcgccgctaaactgggtt
ctggttaacggcgaaagcgaaacgggcgtaacgctgcatcgtatggtcaaacgtgccgac
gccggagagattgtcgccagtcaacgcgtcgctattgcgcaggacgatgttgcgcttacc
ctgcatcataagctatgtcaggccgcgcgccagttgcttaatagcatcctgcccaccatg
aaatgcggcgatataccttctgttccccagcgtgagtctgactctacgtattatggtcgc
cgcaggccggaagatggccttatcgactggcacaaaccggtttccacggtgcataacctg
gtgcgggcggtagccgccccctggcccggcgcgttcagctataacggctcgcaaaaattc
actatctggtcttcccgaatgtgtccggatgcgcaaggcgcgcttcccggctcggtaatt
tcggtctctccgctgcgggtcgcctgcgccgatggcgcgctggagattattaccggccag
gccggagacgacattactgtacagggctcgcagcttgcacagacgcttggtctggtggcg
ggcgcgcgtttgaaccgtccaccagcgaccagcggtaaacgtcgcattcgcgttctcatc
ctcggcgtcaacggttttatcggcaatcatttgaccgaacggttactgaatgaagagaat
tacgaggtctacggtatggatatcggcagcaacgccattagccgattcctgctccaccct
cgatttcatttcgtggagggagatatcagcatccactcagaatggatcgaatatcatgtc
aaaaaatgcgatgtcgtactgccgctggtagcaattgcaaccccgattgaatacacccgc
aacccgctgcgcgtctttgaacttgattttgaagaaaacctgcggattatccgttattgc
gtgaaataccgtaaacgcgtggttttcccgtctacctctgaagtgtacggcatgtgtacg
gacgcctcttttgacgaagacaaatcgaatctgatcgtcgggccggtgaataagccgcgc
tggatttactccgtttccaaacagcttctcgaccgggtgatttgggcttatggcgaaaaa
gagggattgcgcttcacgcttttccgtccctttaactggatggggccgcggctggatagc
ctgaacgcggcgcgtatcggcagttcacgcgcgataacgcagttgattctgaacctggta
gaaggaacgccgatcaagcttatcgacggcggtcagcagaagcgctgttttaccgatatt
cgcgatgggatcgaagcattattccgcattattgtgaatgatggcgatcggtgcgatggc
aaaatcattaatatcggcaatcctgacaacgaagccagtattcaggaactggcgacgctg
ttgctcgacagttttgataagcatccgctgcgctgccatttcccaccgtttgccggtttc
caggtcgtcgaaagccgtagttattacggcaagggttatcaggatgtcgcacaccggaaa
cccagtatcgacaatgccaggcgctgtctgggctgggagccgtctattgcgatgcgtgat
acggttgaagaaacgctggacttctttctgcgtagcgtcgatatcgcggaacgcgcatca
tga

DBGET integrated database retrieval system