KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_08985Help
Entry
STU288_08985      CDS       T02639                                 

Gene name
ndk
Definition
(GenBank) mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
setu00230  Purine metabolism
setu00240  Pyrimidine metabolism
setu01100  Metabolic pathways
setu01110  Biosynthesis of secondary metabolites
setu01130  Biosynthesis of antibiotics
Module
setu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
setu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
setu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
setu_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:setu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STU288_08985 (ndk)
   00240 Pyrimidine metabolism
    STU288_08985 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:setu04131]
    STU288_08985 (ndk)
Enzymes [BR:setu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     STU288_08985 (ndk)
Membrane trafficking [BR:setu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    STU288_08985 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AGK09405
Position
complement(1872797..1873228)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGSIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLESENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD
SLESAQREIAFFFGEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacggactttttccatcattaaacccaacgcggtggcaaaaaacgttatt
ggcagcatctttgcgcgctttgaagctgcagggttcaaaattgttggcactaaaatgctg
cacctgaccgttgagcaggcgcgcggcttctatgctgagcacgacggcaagccgttcttt
gacggtctggtggagttcatgacctctggccctatcgtggtatccgtgctggaaagtgaa
aatgcggtacagcgtcaccgcgatctgcttggcgccaccaatccggcgaacgcgttggcg
ggtacgctgcgcgccgactacgctgatagcttaactgaaaacggcacccacggttcggat
tcgctggaatccgcgcagcgcgaaatcgcctttttcttcggtgaaggcgaagtgtgcccg
cgcacccgttaa

DBGET integrated database retrieval system