KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_16975Help
Entry
STU288_16975      CDS       T02639                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
setu00620  Pyruvate metabolism
setu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:setu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STU288_16975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:setu02000]
    STU288_16975
Enzymes [BR:setu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     STU288_16975
Transporters [BR:setu02000]
 Other transporters
  Primary active transporters [TC:3]
   STU288_16975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AGK10991
Position
complement(3518976..3519449)
Genome map
AA seq 157 aa AA seqDB search
MTIAITDVVLRDAHQSLFATRLRLDDMLPIAAALDDVGYGSLECWGGATFDACIRFLGED
PWLRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKPPCRRCAATAHTPRARSPTPPARRTPCRPGWI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgccattaccgatgtcgtcctgcgtgacgctcaccagtctctgttcgccacc
cgcctgcgccttgatgacatgctgccgattgccgccgcgctcgatgacgtgggctacggg
tcgctggagtgctggggcggcgccacctttgacgcctgcatccgctttctcggcgaggac
ccgtggctgcgcctgcgcgagctcaaaaaagccatgccgaagactcccctgcagatgctg
ctgcgcggccagaacctgctcggctatcgccactacgccgatgacgtggtggaacgcttc
gtcgaacgcgccgtcaaaaacggcatggacgtgttccgcgtcttcgatgccatgaacgac
ccgcgcaatatgaaaccgccctgcaggcggtgcgcagccacggcgcacacgcccagggca
cgctctcctacaccaccagcccggcgcacaccctgcagacctggctggatttaa

DBGET integrated database retrieval system