KEGG   Salmonella enterica subsp. enterica serovar Typhimurium U288: STU288_21000Help
Entry
STU288_21000      CDS       T02639                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
setu  Salmonella enterica subsp. enterica serovar Typhimurium U288
Pathway
setu00620  Pyruvate metabolism
setu00630  Glyoxylate and dicarboxylate metabolism
setu01100  Metabolic pathways
setu01110  Biosynthesis of secondary metabolites
setu01120  Microbial metabolism in diverse environments
setu01200  Carbon metabolism
Module
setu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:setu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STU288_21000
   00630 Glyoxylate and dicarboxylate metabolism
    STU288_21000
Enzymes [BR:setu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     STU288_21000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AGK11790
Position
4396915..4398516
Genome map
AA seq 533 aa AA seqDB search
MNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDIDN
GKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANNG
HDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKTLFR
EMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgagctg
gaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgtttt
acgccaaaacgcaataaactcctggctgcccgtatccagcaacagcaggatattgataac
ggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcagatt
cgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaacgt
aaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaagac
tcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcggtg
aacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgatccg
gccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctggcgg
ggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactataaa
gcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctggcag
gaggcagcctggtggagcgaagtgttcagctacgccgaagaccgctttaacctgccgcgc
ggtacgatcaaagcgaccctgttgattgaaacgctgccggctgttttccagatggatgag
attcttcatgcgctgcgtgatcatatcgtcggtctcaactgtggtcgctgggattatatt
ttcagctatatcaaaacgttgaaaaatcacccggatcgcgttttgccggacaggcaggtg
gtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaaacctgccac
aagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgttgaa
cgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaacggc
cacgacggcacgtggattgcgcatcctgggttggcggataccgcaatggccgtctttaac
gaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccgatt
accgctgaacagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgcgcc
aatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgtaccg
atttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctggcag
tggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaaacgcttttccgc
gaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctacagc
agcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgactta
atcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system