KEGG   Streptococcus equi subsp. equi 4047: SEQ_2106
Entry
SEQ_2106          CDS       T00877                                 

Name
(GenBank) putative formate acetyltransferase
Organism
seu  Streptococcus equi subsp. equi 4047
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: CAW95443
UniProt: C0MAD7
Position
complement(2121207..2123624)
AA seq 805 aa
MTEAKNPYFGTLTERMHRYREAVLDKKPYIDAERAILATEAYQKHQNKPSNLKRAYMLQN
ILENMTIYIEDESLIAGNQASSNKDAPIFPEYTLEFVLNELDLFEKRDGDVFYITEETKQ
QLRELAPFWENNNLRARCGVLLPKEVQVYMETGFFGMEGKMNSGDAHLAVNYQKLLEVGL
KGFEERTRAAKAALDLTIPESIDKYHFYDSVLIVIAAVKAYAERYAKLARELAKTANPER
QAELLEIARICDKVPYQPAETFAEAVQSVWFIQCILQIESNGHSLSYGRFDQYMYPYAKA
DLEAGRETEDSIVERLINLWIKTLTINKVRSQAHTFSSAGSPLYQNVTIGGQTRDKQDAV
NPLSYLVLRSVAQTKLPQPNLTVRYHKGLDNRFMNECIEVMKLGFGMPAMNNDEIIIPSF
IKKGVLEEDAYDYSAIGCVETAVPGKWGYRCTGMSYINFPKILLITMNDGIDPASGKRFA
TGHGHFKDMTSYDELKAAWDATLREITRMSVIVENAIDLGLEREVPDILCSALTDDCIGR
GKTLKEGGAVYDYISGLQVGIANLSDSLAALKKLVFEEGRLTTDELWHALETDFAGERGE
EIRQMLINDAPKYGNDDDYADSLVVEAYDTYIDEIAKYPNTRYGRGPIGGIRYSGTSSIS
ANVGQGKGTLATPDGRHAGTPLAEGCSPEHSMDKKGPTSVLKSVAKLPTDEIVGGVLLNQ
KVNPQTLAKEEDKMKLMALLRTFFNRLHGYHIQYNVVSRETLIDAQKNPEKHRDLIVRVA
GYSAFFNVLSKATQDDIIERTEHTL
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgactgaagcaaagaatccctattttggtacattaacagaaagaatgcaccgctatcgt
gaggcagttctagataaaaagccttatattgatgctgagcgtgctattttagcaacagag
gcttaccaaaaacaccaaaacaagccatctaatctaaaacgcgcttacatgctgcaaaat
attttggaaaacatgaccatctacattgaggacgaaagcttgattgctggtaatcaggcg
tcttctaacaaggatgcacctatctttccagagtacactcttgaatttgtcctaaatgag
cttgacctttttgaaaagcgtgatggcgatgtgttttacatcactgaagaaaccaagcag
cagcttcgcgagcttgcacccttctgggaaaataacaatttgcgggcccgctgtggtgtc
ttgctgccgaaagaggttcaggtttatatggaaactggcttctttggcatggaaggcaag
atgaattcaggagatgcccatttagctgtcaattaccaaaagctattagaggttggcttg
aagggctttgaggaacggactcgtgctgccaaggctgcgcttgatttgactattcctgaa
agcattgataagtaccatttttatgattctgttctgattgtgattgctgcggttaaggct
tatgcagagcgctatgccaaattggcgcgtgagctggccaaaacagctaatccagagcgt
caggcagaattgcttgaaatcgcgcgtatctgtgacaaggtgccttaccagccggcggaa
acctttgctgaagcggtccaatcagtttggtttatccagtgtattcttcagattgagtca
aatgggcattctctttcttatggccgatttgatcaatacatgtatccatatgccaaggct
gatttggaggctggtcgtgaaacagaggattctatcgttgagcgcttgattaacctttgg
ataaagactctgaccatcaataaggtacgcagtcaggctcataccttctcatcagcaggt
agtccgctgtatcaaaatgtcaccattggtgggcaaaccagagataagcaggacgctgta
aatcctctatcctacctagtgcttcgcagtgtggctcaaaccaaattaccacaaccaaac
ctaaccgttcgatatcacaagggcttggataatcgttttatgaatgaatgcattgaggtt
atgaagcttggctttggtatgccagctatgaacaacgatgaaatcatcattccgtccttt
atcaaaaagggtgtccttgaagaagacgcctatgattattcagcaattggctgcgttgag
acagccgttccaggtaaatggggctatcgctgtactggtatgagctacattaactttccg
aagattttgcttatcaccatgaatgatggtattgacccagcttcgggtaagcgctttgca
acaggacatggtcacttcaaggatatgacctcttatgacgagctaaaggcagcttgggac
gcgactctgcgtgaaatcactcgcatgagtgtcatcgtagaaaatgccattgaccttggg
cttgaacgagaggtgccagacattctttgctctgcattgaccgatgattgtatcggccga
ggcaagacgctcaaagaaggtggagcagtctatgactacatctcaggcttgcaggtgggg
attgctaacctgtctgattccctagctgcactgaaaaaattggtgtttgaggagggtcgc
ctaaccactgatgagctctggcatgctctagaaacagactttgcaggtgagcgtggtgaa
gagatccgtcaaatgctgattaacgatgcaccaaaatatggtaatgatgatgactatgct
gatagcttagtggttgaagcctatgatacctacattgatgaaattgctaaataccctaat
acgcgctacggacgtggtccgattggtggtattcgctactcaggcacctcatctatttca
gctaatgtcggccaaggtaagggaaccttagctaccccagatgggcgtcatgcaggaaca
ccgcttgctgagggctgctcaccagagcacagtatggataaaaaaggaccaacttctgtt
ttgaaatccgttgccaaattgccaacagatgaaattgtaggtggggtcttactcaaccaa
aaggttaatcctcagacactagcaaaagaagaagacaagatgaagctgatggctctgctt
cggaccttctttaacaggctacatggctatcatattcaatacaacgtcgtctcacgtgaa
acgcttattgatgctcaaaagaatcctgaaaagcaccgcgacttgattgtgcgtgtggca
ggctattcagccttctttaatgttttatcaaaagccactcaggacgatatcatcgaacgt
accgaacacacactatag

DBGET integrated database retrieval system