KEGG   Streptococcus equi subsp. equi 4047: SEQ_0044Help
Entry
SEQ_0044          CDS       T00877                                 

Definition
(GenBank) aldehyde-alcohol dehydrogenase 2 [includes: alcohol dehydrogenase; acetaldehyde dehydrogenase]
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00010  Glycolysis / Gluconeogenesis
seu00071  Fatty acid degradation
seu00620  Pyruvate metabolism
seu00625  Chloroalkane and chloroalkene degradation
seu00626  Naphthalene degradation
seu00650  Butanoate metabolism
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_0044
   00620 Pyruvate metabolism
    SEQ_0044
   00650 Butanoate metabolism
    SEQ_0044
  Lipid metabolism
   00071 Fatty acid degradation
    SEQ_0044
  Amino acid metabolism
   00350 Tyrosine metabolism
    SEQ_0044
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SEQ_0044
   00626 Naphthalene degradation
    SEQ_0044
Enzymes [BR:seu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SEQ_0044
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SEQ_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAW91949
UniProt: C0M9G9
Position
53506..56148
Genome map
AA seq 880 aa AA seqDB search
MTEKNSTVETTSVAATIDALVQKGLVALDKMRQLTQEQVDYIVAKASVAALDAHGELAKH
AYEETGRGVFEDKATKNLFACEHVVNNMRHQKTVGIIEEDDVTGLTLIAEPVGVICGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPEDCVQWIET
PSLEATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYDEFVSEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKPAAWIAEQAGFTVPEGTNILAAECKEVSENEPLTREKLSPVIAV
LKAESRTDGVEKARQMVEFNGLGHSAAIHTADADLAKEFGTKIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAVNLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTVMKG
TELMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGFIAA
DTGMDVLTHATEAYVSQMANDFTDGLALQAIKIVFENLEKSVKEADFESREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPASTPEEGVESYAKAVYDLGCRLGIKMNFRDQGIDEEEWKAHTRELA
YLAYEDQCSPANPRLPMVEHMEEIMNDAYYGYAERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaatagtactgttgaaacaacatctgttgccgcaacaattgacgctctt
gttcaaaaaggtttagtagcgcttgataaaatgcgtcagttaactcaagaacaggttgac
tacattgtagcgaaggcctctgttgctgctttggacgcacatggtgagttagctaagcat
gcctatgaagaaactggtcgcggagtttttgaagataaggctaccaaaaaccttttcgca
tgtgagcacgttgttaataacatgcgtcaccaaaaaacagtaggtatcattgaagaagac
gatgtaacaggtttgaccttaattgctgagccagtaggtgttatttgtgggattacccca
acaactaacccaacgtcaacagctatttttaaatctttaatctccttaaaaacacgtaac
cctattatttttgccttccacccatcagctcaagaatcatcagctcatgcagcacgcatt
gttcgtgatgcagccattgcagcaggagctcctgaggactgtgttcaatggattgaaacc
ccatcactagaagcaactaacgctctgatgaatcatgatggtattgcaacaatccttgca
actggtggtaatgctatggttaaggcagcctactcatgtggtaagccagctcttggggtt
ggtgctggtaacgtgcctgcctatgttgaaaaatccgctaacattcgtcaggcagcacac
gatattgtcatgtctaaatcatttgacaatggtatggtttgtgcttctgagcaggctgtt
attatcgacaaggagatttatgacgagtttgttagtgaatttaagtcttaccacacttac
tttgtcaacaaaaaggaaaaggctctgttagaggaattctgctttggtgctaaggctaac
agtaaaaactgtgcaggtgctaagctgaaccctaatattgttggtaagccagcagcttgg
attgctgagcaggcaggctttacagtaccagaaggaacgaatatccttgcagcagaatgt
aaggaagtttctgaaaatgagccattaacacgtgaaaaattgtcaccagttatcgctgtt
ttgaaggctgaatctcgcacagatggtgttgaaaaggctcgtcaaatggttgaatttaac
ggacttggtcactcagccgctattcatactgctgatgcagacttagctaaggaatttgga
acaaaaattcgtgctattcgtgtgatttggaattcaccttctacatttggtggtatcggt
gatgtttataatgccttcctaccgtcattaacattgggctgtggttcttatggacgtaac
tcagttggtgataatgttagtgctgtaaatctcttgaacatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagttccttcaaaaacatacttcgagcgtgattcaatt
caataccttcaaaaatgtcgtgacgttgagcgtgtgatgattgttaccgaccacgctatg
gttgagcttggcttcttagatcgtatcatcgagcagcttgaccttcgtcgtaataaggtt
gtttatcaaatttttgcagatgttgagccagatcctgatatcacaacggttatgaaaggt
actgagctgatgcgtaccttcaagccagatacgattatcgctcttggcggtggttctcca
atggacgctgcaaaggtaatgtggttattctatgagcaaccagaggttgacttccatgat
cttgttcaaaaattcatggatattcgtaaacgtgccttcaagttccctgagcttggtaag
aaaacaaaatttgtggctattccaacaacctcaggtacaggatcagaggttacaccgttt
gctgttatctcagataaggccaacaaccgcaagtacccaattgctgactattcattgaca
ccaacggtagccattgttgacccggcgttggtgcttacagtaccaggcttcattgcagct
gatacaggtatggacgtgttgacccacgcaaccgaggcttacgtatcacaaatggctaat
gactttacagatggtttggcccttcaagccattaagattgtctttgaaaaccttgaaaaa
tctgttaaggaagctgactttgagtcacgtgaaaaaatgcataatgcctcaacaatggca
ggtatggcctttgctaatgccttcctgggtatttctcactcaatggctcataagattggt
gcacaattccatactgttcatggacgtaccaatgctatcttgcttccatacgttattcgt
tacaatggtacccgtcctgctaaaacagcaacatggcctaagtacaattactatcgcgcc
gatgaaaaatatcaagacattgctaagttgctaggacttccggcatctactccagaagaa
ggtgttgaatcttatgctaaagctgtttatgatcttggctgtcgcttaggcattaagatg
aatttcagagatcaaggaattgatgaggaagaatggaaggcacacactcgtgagcttgct
tatcttgcctacgaggatcaatgctcacctgctaacccacgcttgccaatggttgagcac
atggaagaaatcatgaatgatgcttattatggttacgcagagcgtccaggacgtcggaaa
taa

DBGET integrated database retrieval system