KEGG   Streptococcus equi subsp. equi 4047: SEQ_0046Help
Entry
SEQ_0046          CDS       T00877                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00010  Glycolysis / Gluconeogenesis
seu00071  Fatty acid degradation
seu00625  Chloroalkane and chloroalkene degradation
seu00626  Naphthalene degradation
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_0046
  Lipid metabolism
   00071 Fatty acid degradation
    SEQ_0046
  Amino acid metabolism
   00350 Tyrosine metabolism
    SEQ_0046
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SEQ_0046
   00626 Naphthalene degradation
    SEQ_0046
Enzymes [BR:seu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SEQ_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N DUF2675 ADH_N_2 Methyltransf_25 Methyltransf_31 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CAW91953
UniProt: C0M9Z0
Position
57898..58914
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQTSSGVEVVEHDVPSIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEKLGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVAGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVETAPEVFDEMERGLIQGRKVLDFTL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtagttgttaaccaaaccagcagtggtgtagaggttgtagagcatgatgta
ccatcaatcggtcatggagaagctcttgttaaagtagaatattgtggcgtatgtcatact
gacttgcatgttgcgcatggtgattttggtcaggttccagggcgtatcctcggtcatgaa
ggtatcggtattgtcgaaaagctaggtgaaggcgttacctccttaaaggttggtgatcgt
gtatcaattgcttggttctttgaaggctgcggtcattgtgaatattgtacaacaggtcgc
gagactctatgccgttcagtcaaaaatgctggctattcagttgatggtgggatgagtgag
tatgcagttgttacagctgactatgctgtgaaagtgccagatggtcttgacccagctcaa
gcatcatcaattacctgtgcaggcgttacaacctataaggctatcaaagaagcaggtgcc
gctccaggacaatggattgttatctttggtgccggtggacttggtaacctagctgttcag
tatgctaaaaaggttttcaatgctcatgtcgtagcagtggacattaacaatgataagcta
gagctggccaaggaggttggagcagatatcgttgtcaatggtaaagaaatcgaagatgtt
gccggctatatccaagaaaaaacaggtggtgctcatggcgttgtggtaaccgctgtttct
aaagtagcctttaaccaagctattgatagtgtgcgtgcaggaggaactgttgttgctgta
ggacttccatcagaatacatggaattatctatcgtaaagactgtcctagacggaatcaag
gtagtcggatcacttgtgggaactcgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgtgccagttgtagaaaaggttccagttgagactgctccagaagtcttt
gacgaaatggaacgtggtctcattcaaggaagaaaggtattggatttcacgctttaa

DBGET integrated database retrieval system