KEGG   Streptococcus equi subsp. equi 4047: SEQ_1580Help
Entry
SEQ_1580          CDS       T00877                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00071  Fatty acid degradation
seu00072  Synthesis and degradation of ketone bodies
seu00280  Valine, leucine and isoleucine degradation
seu00310  Lysine degradation
seu00362  Benzoate degradation
seu00380  Tryptophan metabolism
seu00620  Pyruvate metabolism
seu00630  Glyoxylate and dicarboxylate metabolism
seu00640  Propanoate metabolism
seu00650  Butanoate metabolism
seu00900  Terpenoid backbone biosynthesis
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01200  Carbon metabolism
seu01212  Fatty acid metabolism
seu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEQ_1580
   00630 Glyoxylate and dicarboxylate metabolism
    SEQ_1580
   00640 Propanoate metabolism
    SEQ_1580
   00650 Butanoate metabolism
    SEQ_1580
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SEQ_1580
   00072 Synthesis and degradation of ketone bodies
    SEQ_1580
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEQ_1580
   00310 Lysine degradation
    SEQ_1580
   00380 Tryptophan metabolism
    SEQ_1580
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SEQ_1580
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SEQ_1580
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SEQ_1580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seu04147]
    SEQ_1580
Enzymes [BR:seu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SEQ_1580
Exosome [BR:seu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SEQ_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAW94555
UniProt: C0M9D6
Position
complement(1584850..1585965)
Genome map
AA seq 371 aa AA seqDB search
MIDVYIQRGLRTPIGLAGKQFARVRPELLGAQLINALVKADKLAIDEVICGNAVGTGGNI
GRLMTLYSDLGETVPAITVDMQCASAGAALTMGYAKIKAGLATSLLAGGIESSSLQPQRI
YAAADSRSGAYQVAQFSPDTSSQLAMIAGAERVAQAYQMTPSQLNQWTLTSHQRAHIARQ
KHWLADIILAMPGMSDQGIRPRLSEKVLSKVPPILDKAGLISAANTCLTHDAAAFLVLSN
QRSAYQILDLVEVAGNPKTSPQMVVEASQVLLARNGLAMTDMDAIEWNEAFAVIDLLFEH
YFVEALDRYNIFGGALAYGHPFGASAAIIILHLMQALALKQGRYGLAAIPAAGGQAFALL
LEYHKDYSHAI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtctacattcaaagagggcttagaacgcctattggtctagctggcaagcaa
tttgctagggtgcgtccagaactgcttggtgctcagctgattaatgccttagtcaaagca
gataagctggctattgatgaggtgatctgcggtaatgctgttgggacaggcggtaatatt
ggccggctgatgactctgtattctgacttgggagagaccgtacctgccataaccgttgac
atgcaatgtgcctcggctggtgcagctcttactatgggctatgctaaaatcaaggcaggt
cttgccactagcttgttagcaggagggatcgaaagcagctctttgcagcctcagcgtatc
tatgctgctgctgatagccgatcaggtgcttatcaggtagctcagttttcaccagatacc
agtagccagctggctatgatagcaggagcagagcgggtggctcaggcctaccaaatgacc
ccctcacagctcaaccagtggacccttactagccaccagcgagcacacatagctaggcag
aagcattggttagctgatattatattagcaatgccaggaatgtctgatcaaggcattcgc
cctcgcctgtcagaaaaggtcttgagcaaggtgccgccgatacttgataaggctggcctc
atcagtgctgctaatacctgcttgacccatgacgcagcagcatttttagtgctaagcaat
caaagatcagcctatcaaatccttgatcttgttgaggttgctggcaatcctaaaaccagt
cctcaaatggtggttgaggccagtcaggtcttattagctagaaacggcctagccatgacg
gatatggatgcgatcgagtggaatgaagcttttgcagtgattgatctgctttttgagcat
tattttgtggaggcccttgatcgctacaatatttttggaggcgctcttgcctacggtcat
ccctttggcgcgtcagcagccattatcattttgcatctaatgcaggctttggccttaaag
caaggaaggtatggtttagcagccattccagcagctggtggtcaagcctttgccctgtta
ttggaatatcataaggactactcacatgctatctag

DBGET integrated database retrieval system