KEGG   Streptococcus equi subsp. equi 4047: SEQ_1649
Entry
SEQ_1649          CDS       T00877                                 
Name
(GenBank) putative collagen-binding collagen-like surface-anchored protein FneF
  KO
K13734  fibronectin-binding protein 1
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:seu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    SEQ_1649
SSDB
Motif
Pfam: Collagen TED Gram_pos_anchor TonB_N
Other DBs
NCBI-ProteinID: CAW94669
UniProt: C0MBT8
Position
1656030..1657580
AA seq 516 aa
MKKTMKKMLAASTLCIIMSGSFISGSARVLAEEYYGWNDVTGSKSPFPLYVTPKNGDKNI
KVQQTVVYCFNRDGQWPENWEKRIYESPDKVPHKLPEYNKKSGSDNLFQLLNPKIKIKNP
MAALLAVLEDGYPTSSSSGVNQRTTQLAIWHFTDGLSNLAQFHLTPEETSAYNKLIEKGT
NASNQSENKLLNKTLDIYSYIDGTGDKKHNYQHLLGSTPIPIDNSKENKCQCTKVDLMRT
GDGVKIIVYVDNNGNNRYDNGDKMLKEETIKHGQRGPAGESGKPGPKGDRGETGARGPAG
PQGKPGKQGPRGDKGETGERGPQGEKGEPGKDGQDGKPGEKGEPGIPGPKGEDGKDGAPG
RDGQPGPKGEKGDPGKDGQDGKPGEKGDPGRDGKDGEKGERGEQGPKGERGEQGPQGERG
EQGPRGENHTPTPDPMPEPAPKPESKPEPKPTPQPEVKPLPETKPQKPTKPSAMASQPSS
KALPKTNDTSGLMTVLGTGLLSLLGLGFLAKRKRKQ
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgaaaaaaacaatgaagaagatgctagcagcctcgacgctctgtatcatcatgtcaggc
agcttcatcagcggctcagctagagtgttagcggaggaatattatgggtggaatgatgtc
actgggtctaagtcaccatttcctctatacgtgacaccaaaaaatggagataaaaatata
aaagttcaacaaacggttgtttactgttttaacagggatgggcaatggccagaaaattgg
gaaaaacggatatatgaatctcctgataaagttccacataaattacccgaatataataaa
aagtcaggaagcgataatctgtttcaattacttaatcccaaaattaagataaaaaatcca
atggcagctttattagcggttttggaagatggatatcctacgtcatcttcttcaggagta
aatcaaagaacaactcagctagctatttggcattttacagatggattaagcaatcttgcc
caatttcatcttactccggaagaaacttcagcttataacaagttgatagaaaaagggaca
aatgcttctaatcaaagtgaaaataaactattaaataaaactttagatatttattcctat
atagatgggactggtgataagaaacacaattatcaacaccttcttggctccactccaatt
cctattgataattctaaagaaaataaatgtcaatgtacaaaagttgacttaatgcgaact
ggagatggggttaaaatcattgtttatgttgataacaacggaaataatagatatgacaac
ggcgacaaaatgctaaaagaagaaactatcaaacatggtcaacgcggacctgctggtgaa
tctgggaaaccagggcctaaaggggatcgaggagaaactggagcacgcgggccagctggg
cctcagggcaaacctgggaaacaaggacctagaggtgataaaggagaaaccggagaacgg
ggacctcaaggggaaaaaggtgaacctggaaaagacggacaagatggaaaaccaggggaa
aaaggagaacctggaattcctggtcctaaaggagaagacggtaaagatggggctcctggg
cgtgacggacaaccggggcctaagggtgaaaaaggtgaccctggaaaagacggacaagat
ggaaaaccaggggaaaaaggtgaccctggacgcgatggtaaagatggagaaaaaggcgaa
cgcggtgaacaagggcctaaaggagaacgcggtgagcagggacctcaaggagagcgtggg
gagcaaggacctcgtggggaaaatcatactcctaccccagacccaatgcctgagccggca
cctaaaccagaatccaaacctgaacctaagccgacacctcaaccagaggttaagcctctg
ccagagactaaacctcaaaaaccaaccaagccgtcagcaatggctagccaaccaagtagc
aaagcactaccaaaaacaaatgacactagcggcttaatgactgtacttggaacaggcttg
ctctctcttcttggattaggcttcctggcaaaacgcaaaagaaagcaataa

DBGET integrated database retrieval system