KEGG   Streptococcus equi subsp. equi 4047: SEQ_2113Help
Entry
SEQ_2113          CDS       T00877                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00230  Purine metabolism
seu00250  Alanine, aspartate and glutamate metabolism
seu01100  Metabolic pathways
Module
seu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:seu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SEQ_2113
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SEQ_2113
Enzymes [BR:seu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SEQ_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CAW95454
UniProt: C0MAE4
Position
complement(2128866..2130158)
Genome map
AA seq 430 aa AA seqDB search
MTSVVVVGTQWGDEGKGKITDFLSSDAEVIARYQGGDNAGHTIVIDNKKFKLHLIPSGIF
FPEKISVIGNGVVVNPKSLVKELAYLHEEGVTTDNLRISDRAHVILPYHIKLDQLQEEAK
GDNKIGTTIKGIGPAYMDKAARVGIRIADLLDRDIFAERLKTNLAEKNRLFEKMYDSAPI
AFDEIFEEYYAYGQEIKKYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREIGHEYGTTT
GRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLETVKICVAYDLDGKRIDHYPASL
EQLKRCKPIYEELPGWSEDITGVRSLEDLPENARNYVRRIGELVGVRISTFSVGPGREQT
NILESVWATI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagtagtagtagttggtacccagtggggtgacgaaggtaagggtaagatcact
gactttttatcctcagatgcagaagtgattgcacgttaccaaggtggtgacaatgcagga
cataccattgttattgataacaagaaattcaagctgcacctgattccatcaggtattttc
ttcccagaaaagatttctgtgattggaaatggtgtggttgtcaatccaaaatccttggtt
aaggagcttgcttacctgcatgaggagggcgtgaccacagacaatttgcgcatttctgat
cgtgctcatgtcattttgccataccatatcaagcttgaccagcttcaagaggaagcaaag
ggtgacaataaaatcggtaccaccatcaagggcatcggtccagcctatatggataaggca
gcacgtgttggtatccgtattgcagacctgttagacagggatatttttgctgagcgctta
aagacgaatctggctgagaaaaatcgtctttttgagaaaatgtatgacagcgcaccgatt
gcatttgacgagatttttgaagaatactatgcttatggtcaagagatcaaaaaatatgtg
acagacacatctgttattttgaacgacgctcttgatgcgggcaagcgtgtcctttttgag
ggagctcaaggggttatgcttgatattgatcagggaacctatccatttgtcacctcatct
aatccagttgcaggcggtgtgaccattggttcaggagtcggaccaagcaaaatcaacaag
gttgttggagtatgtaaggcctatactagtcgcgttggtgatggaccattccctaccgag
ttatttgacgaggttggtgagcgcattcgtgagattggtcatgagtatggaacaaccact
ggtcgtccacgtcgcgttggctggtttgattctgttgtgatgcgtcatagccgtcgtgtg
tcaggcattaccaatctatcacttaactctattgatgtgctatcaggccttgagactgta
aaaatctgtgtcgcttatgaccttgatggtaagcgcattgatcattacccagcaagcctt
gagcagctaaaacgctgcaaaccgatttatgaagagcttccaggctggtcagaggatatt
accggtgttcgcagccttgaggatctcccagaaaatgctcgcaactatgttcgtcgtatt
ggcgaactggttggtgttcgtatctcaaccttctcagtaggtccaggacgtgagcaaacc
aatatccttgaatctgtttgggcaactatctaa

DBGET integrated database retrieval system