KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02641
Entry
STMMW_02641       CDS       T01715                                 

Definition
(GenBank) conserved hypothetical pathogenicity island protein
  KO
K11902  type VI secretion system protein ImpA
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Brite
KEGG Orthology (KO) [BR:sev00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02641
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02641
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: CBG23280
UniProt: A0A6C7I9S4
Position
complement(304651..305706)
AA seq 351 aa
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDAR
RLLTRSKDIRVLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAES
IEDASLARSNALAALLDHEGVMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPES
VRQQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAPDFSRLRQLLALLPDVVQT
TTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISLPHNAEPGPIRDRNDALER
LRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggacatgtccctgactaaaccggtaagcgcggaacaaccctgcggccccgatccggag
tacgatccggaatacctgctgctgttcagccgcgccgccccccaggcggaggcgcaatat
ggtgattttgtcagtacgccggaagccgtgaactggccggaaattgaacgtgatgcgcgc
cgtctgctcacgcgcagtaaggatatccgggtgttgatcctgctgctgcgcagtcgcatc
cagcaggctggcgcacagggactggcggaaatgctcacacaactggcagaactgagcgta
atctggtctgatgcactccatccacagctgcttaccggcgaaggcgcatccgcagaatct
attgaagatgcgtcgctggcgcgcagtaatgccctggcggcgctgctggatcacgaaggc
gtgatggcggacattcgcggtattacgctgtcaaacagtgccgccctgcgcctacaggta
cgggatgtggagcgcgcgttatccgctccccgcccggctgatgcgctggcccccgaatcc
gtccgccagcaactggccgacctcgaagcccgtggggcattaccgctggcggcgtttcgc
gaagcgcaggaaagcgcagaacgcctgcaagtgtgggcgcgtgagacattaggcgatctg
gctccagatttttcacgcctgcggcagttgttagcgctgctgcctgacgtggtacagaca
accacaccggaaatccctccgtcgccagcgccagtgccagaccccgcaggcacggttatg
gataatgccgttccggcacgggcagaggatgtgccgcctgtcaacgcgccacccggtata
tccctcccacacaatgctgaaccggggccaattcgcgatcgtaatgatgcgctggaacgc
ctgcggtgcattcgtcgctggtttgagagcagtgaacccagtagcccgaccatcccactg
ttacgccaggctgaaagactggtgggaaaacggttctcggaggtgatcaatgagatcccg
gtggagttgctggagaagtgggatgccctggagtga

DBGET integrated database retrieval system