KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02651
Entry
STMMW_02651       CDS       T01715                                 

Definition
(GenBank) type VI secretion protein
  KO
K11895  type VI secretion system protein ImpH
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Brite
KEGG Orthology (KO) [BR:sev00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02651
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02651
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CBG23281
UniProt: A0A6C7I7A2
Position
complement(305717..306712)
AA seq 331 aa
MTGALNQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIA
QVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQF
WQAWRSAQSAGGGLDKPEHDRFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRN
PDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQSSVLGNGALIGQAVPDMQY
KFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCWEIELQLKPHAAPPAVIGGA
QRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaccggcgctctcaaccaggcgcagaaaaccccctggcgttacggattcctgaacctg
atgcggcgcgtggatgcccagctctgtgatactccggcaggcagtatctggcagccacgg
atggaaaaattccgtctgggacagacgccgacgatgacctttgcgccacgggaaatcgcc
caggtcagctggcaggatggacgcctgcacctgagcctgtacagcctcggactatggggg
ccaaacggcccgttgccgctgcactataccgagctggcactgaaccgctcagagagtcgt
cacgatccgacgctggttcatttttccaatatttttcaccaccgctggctgacgcagttc
tggcaggcatggcgcagcgcccagtccgctggtggcgggctggacaaaccggaacacgac
cgttttgcgttttatatcgccagtctcagcgggcaggatctacgggaaagcgccgaaagc
ccgctgtcagatcatgttcgcctggcagcctccgcccatctggtacgcgaatcgcgcaat
cctgacgggctggccgccacgctggcgcactatttcagcgtaccttttgcggtgaaagaa
ttcgccctgcactggataacggtggcgaacgatgaaatcacccgtctgggcacgcccgcg
cagtcttcggtgctgggcaacggggcgcttatcggccaggccgtaccggatatgcagtac
aaattccggctaattatcggcccgctcacgctggaggattacctgcgttttctgcccggc
ggcaacaatctgcccgtgctgacagaactggtgcgtacgttcatcggttttgaatattgc
tgggaaattgagctgcagttgaagcctcatgccgcaccgcctgcggtgatcggcggcgcg
cagcggcttggctggacggcctgggcaggtaaagccatgcatgaccgtccggtgaccggc
atgatttttgaacctgaacacggcttaacccactga

DBGET integrated database retrieval system