KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02661
Entry
STMMW_02661       CDS       T01715                                 

Definition
(GenBank) type VI system protein
  KO
K11896  type VI secretion system protein ImpG
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Brite
KEGG Orthology (KO) [BR:sev00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02661
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02661
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CBG23282
UniProt: A0A6C7I8C4
Position
complement(306709..308592)
AA seq 627 aa
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSART
QLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPI
PEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFG
ELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGEPGHFDGELNVNLQHPVAH
EGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGLSAGLQKVQGNVAEIVILLN
RLPPDWLIHQTDAAQFSLFCTPVINLLPRTTTRIEVTHSVTEQHLVVDRTRPLDYEVFSV
QEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
VFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPP
RPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRS
LIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINT
FSQMTLHSMQRGHVMTWPVRTGQRGSV
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggatccacggctactggagtattacaaccgcgaactgagctacctgcgggagaccggt
gctgagttcgccaccctccatcccaaaattgccgcccgactggggatgcagggaaccgat
attgccgacccgtatgtggaacgcatgatcgaggcgttcagctttctgagcgcccgcact
cagctaaaaattgacgccgagtttccccgcttcacacagcggttactggaagtcgtcagc
cccaattacgtcacccccacgccatcgatggcagtggtaaagctgtatcccgatacgcag
gaaggcgacctggcgaaaggggtcaccgtgccgcgcgataccgcgttcgtttcccccatc
ccggaaggcgaaaataccgcctgccagtttcgcagcagccaggacgtcacgctgtggccg
ctgtccatcgaggaggtacgcctgaccgccgcgccgccggatatgcccgccctgcaccgc
tatctgccgcctaatattcatgtcgccggggcattgcgcatcaccctgcgaaccttcggg
gaactgactttcagcgagctggccggtccggcacggctgcccttttacctctgcggcgaa
gaacgcattgcgtcacacctgtttgagctgctacataccagcgccgtcgccacactggcc
ggtgaacccggtcactttgacggcgaactgaatgtgaatcttcaacacccggtggcgcac
gaagggctggagccagggcaggggctgctaccgctcgcctggaacgtgtttcacggccat
aatctgctgcatgaatttttcgcctgtccggaacggttttacttcttcaccccgaccgga
ttgtctgccgggttacaaaaggtgcagggcaatgtggcggaaattgtcatactgcttaac
cgcctgccgccggactggctgattcatcagacggacgctgcacagttcagcctgttctgt
acgccggtgatcaacctgcttcctcgcaccaccacccggattgaagtcactcacagcgtg
acggaacagcatctggtggtggatcgtacccgtccgctggattacgaggtgttttctgtt
caggaagtcgaaggcctggaagcggaaaccacacggaagatgatttttcgtccgctgtat
cacacccgtaataatgacgaaggcaaccacgggcgttatttttcactgcgtcgtgaaccg
cgccgctcgtcagaaaacgcccgccgctatggcacccgaaccccctataccggctcggaa
gtcttcctctcgctggttgatcagcatgaagcgccctacccggaaaatctgcgccatatc
accgtcacggcaatggtgactaaccgcgatctgccctgccttattccacgtaatggccgg
gatgatctgaccgtagatgcggcgattccggtggcgggcgtgggtcttatcagaccgccg
cgcccgccgcagccgccgctggctgaacgcgaaatggcctggcggctgatccggcagttg
tcgtttaattatctgccgctggccgatctggatcaccgcaccggcggccaggcgctgcgc
gatctgctgaatctgtttatcccggctcacgacagcccgcagtcgcgccaggtgcgcagc
ctgattggctgcaaaaccaccccggtgacccgccgcctgcccggctccggcctgttggtc
tatggccggggcgtcagttgcgaactgaccgtggacgaagaaggattttccggtatcagt
ccttacctgttcggtctggtgctggaacactatattgcccgccatgtttccattaatacc
ttctcgcagatgacgctgcactcgatgcaacgcgggcatgtcatgacctggccggtcaga
accgggcaacgggggagcgtatga

DBGET integrated database retrieval system