KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02671
Entry
STMMW_02671       CDS       T01715                                 

Definition
(GenBank) putative type VI system cytoplasmic protein
  KO
K11897  type VI secretion system protein ImpF
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Brite
KEGG Orthology (KO) [BR:sev00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02671
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02671
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CBG23283
UniProt: A0A6C7I6S6
Position
complement(308608..309102)
AA seq 164 aa
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGD
IDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLL
DKTRQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSRITFF
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagcacgtctcgttttacacccgctaaccacctgctgcccacgctgtttgatcggctg
tgtgacaatgctccgtatcagaaaattgaccgggatatcagcgtcacgccggtacaactg
aaggagatcattcgccgggatctctcctttttgctcaataccattagccacgagggtgac
atcgacgcccggcgctatccgcaggcggcggcgtcagtgctcaactatggcctgccgccg
ctggcgggcagctttatgtatgagcataagtgggacgatatcagcgaggcgatccggcgc
gccattatccgtttcgaaccccggctgaacgccgccacactcagggtcacgcccttgctc
gataaaacccggcagggtagctataacacgctacagtttgaaattcgcggacaaattctg
acgcagccgtatcccacggagtttctggtacgcagcgcgctggatatggagctgagccgc
attacgttcttttaa

DBGET integrated database retrieval system