KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02741
Entry
STMMW_02741       CDS       T01715                                 

Definition
(GenBank) type VI system secreted protein
  KO
K11900  type VI secretion system protein ImpC
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Brite
KEGG Orthology (KO) [BR:sev00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02741
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02741
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: CBG23288
UniProt: A0A6C7I8C9
Position
314485..315978
AA seq 497 aa
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAY
KSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKD
ELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAK
VAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSRYIGLT
MPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAAYAMGVNINRSFKHYGWCTLI
RGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKNSDYAA
FIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQR
WLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLT
GSLRLVTKLPSVKQGNA
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggcaaacagtaatatgcaggcaaccgacgcggttgctcaggataccgcctccgcatcc
ggtgaatttgatgcgttgctgaatcaggccttccgacccaagactacccaggcggcaaaa
gccgtggaagccgcggtgcagacgctggcgaacacgatcaccgtcagcgatgacgcctat
aaaagcatcagcgctattattgcgcagatcgactttaaactgaccgaacagatcaaactg
atcctgcaacatcccgactggcagaagctggaatcctcgtggcgcggtatggagcatctg
gtttacaacaccgagaccgacgaaaagctgaaaattcgcttcatgaatctgtcaaaagat
gaattgcggcgcaacatgaagcgttacaagggcatcgcctgggatcaaagcccgatgttc
aagaaactgtatgaagccgaatacggccagttaggtggcgaaccttatggctgtatcatt
gcggattactacttcgaccatacaccgcccgatgtggatctgcttggctctatcgccaaa
gtcgccgcgtcggcccatgcgccgtttattgccggggcttccccctcggtactgcaaatg
gactcctggcaggaactggcgaatccccgcgacctgaccaaaatcgtcacccagaacctg
gaatatgcgccgtggaactcgctgcgggctagcgaagactcccgttatattggcctgacg
atgccgcgttttcttgcccgcctgccgtatggcgcaaaaaccaacccggtggacgagttt
gattttgaagaagatgcggatggttctgaccataccaaatacgtctggagcaacgcggcc
tacgcgatgggcgtaaacatcaaccgttccttcaaacactacggctggtgtacgttgatt
cgcggtgtggaatcaggcggtgcggtggaaaatcttccctgccataccttcccgactgac
gatggcggcgtggacatgaaatgcccgaccgaaatcgccatctctgaccgccgcgaggct
gaactggcgaaaaacggttttatcccgttgatccaccgtaaaaactcagactatgccgcc
tttatcggcgcacagtcgctgcaaaaaccacaggaatactacgatccggacgcgacggcc
aacgctaacctgtctgcccgtctaccgtacctgttcgcctgctcgcgcttcgctcacttc
ctcaaatgtatcgtccgcgacaaaatcggttcctttaaagagcgtgaggatatgcagcgc
tggctaaatgaatggattatgaattatgtcgacgccgatccggtgaactcctcgcaagaa
actaaagcccgtcgtccgctggctgccgctgaagtagtggtggaagaggtcgaaggcaat
ccaggttattacgacgcgaaattcttcctgcgtccgcatttccagcttgaagggctgacg
ggatcgctgcgcctggtgacaaaactgccgtcagtgaagcagggcaatgcctga

DBGET integrated database retrieval system