KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02791
Entry
STMMW_02791       CDS       T01715                                 

Definition
(GenBank) putative hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sev00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STMMW_02791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02791
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02791
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CBG23291
UniProt: A0A6C7I7B1
Structure
PDB: 
5XHH

Position
316864..317349
AA seq 161 aa
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDH
YIDRASPNLFKYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIA
SRETVELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcttatgacatttttttgaaaattgacggcattgatggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggcctcggctccggtaaggtctccgtcaccaacctggattttgatcac
tatatcgaccgcgccagcccgaacctgttcaaatactgcgcctccggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtatacc
ttcaccgacctgattgtcgccgtggtttccccgagcggcagccacgatggtgaaatcgcc
tcccgtgaaacggtggagctctccttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggcggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system