KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02841
Entry
STMMW_02841       CDS       T01715                                 

Definition
(GenBank) putative hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sev00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STMMW_02841
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02841
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02841
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CBG23294
UniProt: A0A6C7I7W1
Structure
PDB: 
5XEU

Position
318650..319135
AA seq 161 aa
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLSFEH
YIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIA
SRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcttatgacatttttctgaaaattgacggcattgacggcgagtcaatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatattcatcaggaatccaccatg
cacgccggtagcggtctcggttccggtaaggtctccgtcactaatctttcatttgaacat
tacatcgatcgcgccagcccgaacctgttcaaatactgctcttccggtaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtacact
ttcacagatctgattattgcaatggtatcgcccagcggaagccagggaggggaaattgcg
tctcgcgaatcaattgaactctccttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggtggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system