KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02851
Entry
STMMW_02851       CDS       T01715                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sev00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STMMW_02851
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02851
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02851
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CBG23295
UniProt: A0A6C7I818
Position
319202..319738
AA seq 178 aa
MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAP
IEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTA
IGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFISGKGKVQLEAELEQSAIVITERDK
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgaatgaatggcgtaaccccactcggtggttatgtgcggtagctatgccttttgcactg
ctcctgctttccggatgcggcagtagcgatgcgttacctgacctcgaatcacagcgactc
gacctgagcgtgaaagcctccgataaggtgaatcctgacaatcagaagaaggccgcgccc
attgagatacgtgtttatgaactgaaaaatgacgccgctttcacgacagctgattactgg
tcgctccatgacaacgacaaatccgtccttaccgacgatttagtgcgtcgcgacagcttt
attttgcgtcccggcgaagagaaaaaactgcgtcgcccgctgaatgcgcagaccacggca
atcggcgtactggccggataccgtaacctggccaaatcggtctggcgggtaacctacaaa
atcccggaagccccggaaaaagcctggtacagcagcttcatatcggggaaaggaaaagtg
cagttggaggcggaactggaacaaagcgccattgtaattacggaacgggataaatga

DBGET integrated database retrieval system