KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_02901
Entry
STMMW_02901       CDS       T01715                                 

Definition
(GenBank) type VI system protein
  KO
K11891  type VI secretion system protein ImpL
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sev00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    STMMW_02901
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sev02044]
    STMMW_02901
Secretion system [BR:sev02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   STMMW_02901
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: CBG23300
UniProt: A0A6C7I9U3
Position
323832..327701
AA seq 1289 aa
MQKFLSLLFSRRALAVVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVL
WLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLW
RALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFE
GKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQMEQTSRILTVPGGGTLHCDWWFT
NEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRKHRPGAPLNGVILTLNVADLT
AQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRTLTSHLRAQIW
GFTLPYSRRRKAGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSRQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIK
TARGESSASLPHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVL
VLAFLLWQGMQTSQQTNGDYLNEISARATRLDGDVKAYTGKPAMAPVPALLDSARELSAW
PELDPDAPPLAWRYGLYSVPPVTDSVASLYNRLLDQLLLPPLVKRMEYVLADAIARQDSK
AAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDSVAGFGGRAAVLTHIEALFDG
SRVVHSPYEKDEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLVRAVGADAGTV
FVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPD
SPLMRLGKAVVEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTL
VDDRFAALREVIAGRTDGGQSGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITA
ADKLQLEAAKLPAPLKNILLDLTKQGTRKINAGTGDVLNTQMEAMMGDDCRDAIDGRYPF
ADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDPWRYKPTEGNMTLQGPDLTPF
QQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAHGPDRPLKVTW
PGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
NT seq 3870 nt   +upstreamnt  +downstreamnt
atgcaaaaatttcttagtctgcttttttcccggcgcgcgctggcagttgtgggcgttctg
gttctggcgctgctggtctggtttgtcgggccgctggtgtcatttgataccctgcgcccg
ctggcctccgtgggtagccgggtagtgaccattgccctgttgctgatgctgctggtactg
tggctggtcaactggtcgatgagtatcatcggcatcagtgtcctgtgcctggcgattggc
ttcgtcacaccgctgctggccctgggcgatgtccatccgtttgcgccgctgtgggtccgc
ctgaccctgattggtttcatcctgctgatgtacgcgctgtacggcctgtaccggctgtgg
cgtgcgctgcgtatggatgaacaactgctgcgtcgcttcctgcatccgcgcggggaagag
gtaccggtggcaggcgagatcaaagccgacctgcgcaccgtcaaccatattgtcacgcag
gccatccggcagctgcggcagttgcgggtggatatgcctggctggcgtaaaatcttcgag
ggaaaacgctttctgtatgagctgccgtggttcatggtggtcggcagtcccggcgacggc
aaaaccacggccctgctgaacaccggattgcagttcccgctggcggagcaaatggagcag
acttcgcgcatcctgacagtaccgggtggcggcacgctacactgcgactggtggtttacc
aacgaagcggtgttgattgataccgccggacgctacgcccgccacgatgacggtggtgaa
gcgagcgccgcgcagcgtaacgccggagagtggcagggctttctcggtctgctgcgtaaa
catcgccccggcgcgccgcttaacggcgtgatcctgacgctaaacgtggcggatttaacc
gcacagtcaccggcggaacgcctggcggcctgcgccgctctgcgggcgcgactggcagaa
ctgcgcgagaccctggggattcgctttccggtctatctggtggtcaccaaaatggatttg
ttgccggggttcagcgaatattttcgcacgctgaccagccatcttcgtgcacaaatctgg
ggcttcacgttgccgtacagccgcaggcgaaaagcgggcgacccgcaggcgctgcacgcc
gcctgcgcgcaggagctggcgcgcctgacgctgcggttggatcagggactggatacccgg
ttacaggaagagtacgaccttaaaagccgccagcggctgtataccttcccgcgtgagttc
gccgccctcggcgagccgttgctggaggctattgaacagatcttcctcgattcaaaattc
gatgccacgcaactgaataacacgctgcgcggggtgtttttcaccagcgccgcgcaggcg
caggccgacgccgtggccgaccagttgagtatctggcagcgctttgtccgggcgataaaa
accgcccgtggcgaatcctccgcctctctcccacacgctctgccggacggcaaccgcagc
tacttcctgcatgacctgctgacacagtttatttttcgtgaagcgcacctggtggagcca
aacctccagtgggcctggcgttaccgcctgctgcgcctcggcgggcacctgctggtactg
gtgctggcattcctgttgtggcaggggatgcagaccagccagcagaccaacggcgactat
ctgaatgaaatcagcgcccgcgcgacccggctggacggtgatgtgaaagcctacaccggt
aaaccggcgatggctcccgtcccggcactgctggacagcgcaagggaactgtccgcctgg
ccggaactggacccggacgcgccgccgctggcctggcgctacggtctgtacagcgtaccg
ccggtaaccgacagcgtggcgtcgctgtacaaccgtctgctggatcaactgctgctgccg
ccgctggtgaaacggatggagtatgtgctggcggacgccattgcccgtcaggatagtaaa
gcggcctacgatgccctgcgcatctatctgctactgaatctggataaagatcacgaagat
aaatacaacgcggcggagatccagtcgtgggtgattaacgatctggggaacagcgacagc
gtggccgggttcggcgggcgcgccgccgtgctgacgcatatcgaagcgctgtttgacggc
agccgggtggtgcattcaccgtatgagaaagatgaggcgctgatccgccaggcgcgggca
ttcctcgacggtcacaccagtaccgagcgtatctacgcgcgggcgctggcggcaatggag
agcgaagcgccgcaggagttcacgctggtacgcgccgtcggcgcggatgcgggaacggtc
tttgtgcgtagcaacggcgcgccgctggatcggggcgtgccgggtatttttacccgtgaa
ggataccgggagctgttcgacaaacgattaccggaatttgtggcggcggcgacggcgaac
gatggctgggtgatgggccgggagagtacgccaaaaaagctgactgacagcctgcgcagc
cagataccggggcaggagcagtctgtcgcccgcgaagtccgccgtttgtacctgacggaa
tatgcccgccgctggcaggattttctggacagtatccatagtatcaacagtgccggggaa
gagggcagttccggcctggcctatgatttacaggtgctgcgcaccctggcgtcgccggac
tcaccgctgatgcggctgggaaaagcggtggtggagcagaccacgctggtgccgccgccg
gacccgcaggccagacagaaacaactggcgcagcgcgcatccggtaacgcggggaaagtg
gtacagacggcaaaactgttccaggatattcacccggaagaacggctggaaaaaacgctg
gtggatgatcgtttcgccgcgctgcgcgaggtcattgccgggcggacggacggcggacag
agcggcggtgggacgatgcagatcgcttcgctgctgaccatgctcaacgagtattacacc
caactgaccattgctgatagcgcgctggcggcggggacgttgccagcgcgcattactgcc
gcagacaagttgcaactggaggcggcgaaactgcccgcgccgctgaaaaacatcctgctg
gatctgacgaagcagggaacgcgcaaaatcaacgccgggaccggcgacgtgctgaacacc
cagatggaggcgatgatgggcgacgactgccgtgacgccatcgacgggcgctatccgttc
gccgacagtccgcaggaggtcagcgccgaggactttaaccgcatcttcgccagcggcggc
gtactggatgctttctggagcaaacaactggctccgctggcggacaccgccagcgacccg
tggcgctacaaaccgaccgaaggcaacatgacattgcaggggccggatctgacgccgttt
cagcaggcgaagcagatccgcagcgtattttttaacagcgagggcgggaaaaaattttcc
tggtcgatgcagattagcgtggtggatatggacccggccatcacggaactggtgattgat
atcgacggccaggtgctgcgctacgcccatggtccggaccgtcccctgaaagtaacgtgg
ccgggaccgcgcaacggctcgatggcggaaatcaccgccagcccgcgtattcgccaggac
acctcaacgctactgaccggcgggccgtgggcgctgtttcatctgctggacgccggaatg
gtacaggaaacggcggtgcgggggcgtcaactggtggaatatgattttgacggtcgccgg
gtggtgctggaaatcaccgccgggcgggattttaacccggtcagccgggagctgttgcag
aacttcagttgcccggcgagggcgctgtaa

DBGET integrated database retrieval system