KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_09131Help
Entry
STMMW_09131       CDS       T01715                                 

Definition
(GenBank) glutathione s-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00480  Glutathione metabolism
sev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sev00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STMMW_09131
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sev02000]
    STMMW_09131
Enzymes [BR:sev01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     STMMW_09131
Transporters [BR:sev02000]
 Other transporters
  Pores ion channels [TC:1]
   STMMW_09131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 Tom37 GST_C_5
Motif
Other DBs
NCBI-ProteinID: CBG23921
Structure
PDB: 

Position
complement(973275..973901)
Genome map
AA seq 208 aa AA seqDB search
MITLWGRNNSTNVKKVLWTLEELELPYDQILAGGKFGVNQDADYLAMNPNGLVPLLKDDE
TDLLLWESNAIVRYLAAQYGQNRLWVDNPARRAEGEKWMDWANQTLSPAHRVILMGLVRT
PPEKRDQAAIEAGIEKCDSLFALLDDALAHQPWFSGDNFGTGDIAIAPFVYNLLNVGLKW
TPRPNLERWYQQLTERPAFRKVVMIPVT
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattacgctgtggggccggaacaactcgactaatgttaaaaaagtgttgtggactctt
gaagagctggaactgccatacgatcaaattctggcaggcggaaaattcggcgttaaccag
gatgccgactatctggcgatgaatcctaatgggctggtgccgctgcttaaagatgatgaa
accgacctgttattgtgggaatccaatgccattgtccgctatctggcggcgcaatacggc
cagaaccggctatgggttgataatccggcgcggcgtgcggagggcgaaaaatggatggac
tgggcgaatcaaacgttaagcccggcgcaccgcgtgatcctgatgggactggtcagaacc
ccgccggaaaaacgcgaccaggcggcaattgaagccggtatcgaaaagtgtgatagcctg
tttgcgcttcttgatgatgcgctggcccaccagccgtggttctcaggggataactttggc
accggtgatatcgctattgcgcctttcgtctataacctgctgaacgtgggtctgaaatgg
acgccgcgcccgaatctggaacgctggtatcagcagcttaccgagcgccctgcttttcgc
aaagtggtgatgatcccggtgacctaa

DBGET integrated database retrieval system