KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_23701Help
Entry
STMMW_23701       CDS       T01715                                 

Definition
(GenBank) putative glutathione-S transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00480  Glutathione metabolism
sev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sev00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STMMW_23701
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sev02000]
    STMMW_23701
Enzymes [BR:sev01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     STMMW_23701
Transporters [BR:sev02000]
 Other transporters
  Pores ion channels [TC:1]
   STMMW_23701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_4 GST_N_3 GST_N GST_N_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: CBG25381
Position
complement(2483292..2483936)
Genome map
AA seq 214 aa AA seqDB search
MSKPVIVLWSDANFFSPYVLSAWVALQEKGLSFTLKTRDLDQGEHLQPGWRGYALTQRVP
VLEADNFELSESSAIAEYLEERFAPPQWERIYPHDLQKRARARQIQAWLRSDLLPLREER
PTDVVFAGAKKAPLSEAGKASAAKLFATAEALLGQGTQNLFGEWCIADTDLALMINRLAL
HGDDVPASLAAYATFQWQRASVQRFIALSSKRSG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcctgttattgtgctgtggtcggatgcgaactttttctctccctacgtcttg
tccgcctgggtggcattacaagaaaaagggctttcctttactctgaaaactcgcgatctg
gaccagggagaacatctgcaacctggctggcgaggatatgcgctgacgcagcgcgtaccg
gtgcttgaggccgacaattttgagctgagcgagtcgtccgctattgcggaatacctggag
gagcgtttcgcgccgccgcagtgggagcgtatctacccgcacgatttacaaaaacgcgcc
cgcgcgcgacagattcaggcgtggctacgcagcgatttactgccgcttcgcgaagaacgg
cctaccgacgtagtgtttgccggggcgaaaaaagcgccgctaagcgaggctggaaaagcc
agcgcggcaaaactgtttgcgacggctgaagcgctattggggcaggggacgcaaaattta
tttggtgaatggtgcattgccgataccgatctggcattgatgatcaatcgtctggcgctg
catggcgatgacgtgccggcatcgctggcggcatatgcgacattccagtggcagcgtgct
tccgtacagcgttttattgcgctttcctcgaagcgttcaggctga

DBGET integrated database retrieval system