KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0100Help
Entry
SeSA_A0100        CDS       T00743                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SeSA_A0100 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACF88909
UniProt: B4TWT5
Position
complement(102432..102809)
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDDERYVFAYTVTIRNLGRAPVQLLGRYWLITNGHGRET
EVQGEGVVGVQPRIAPGEEYQYTSGAVIETPLGTMQGHYEMIDENGDAFTIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgcccagagtgtgtattcaggtgcaaagcgtctacattgaggcgcaatcc
tcacctgacgatgaacgttacgtttttgcctataccgtaaccatccgcaatctgggccgg
gcgccagtgcagctgttgggccgctactggctgattaccaatggccatggccgtgaaacc
gaagtccagggcgaaggtgtggttggcgtccagccgcgcattgcgcctggcgaagagtat
cagtacaccagcggcgcggtaattgaaacgccgctgggcaccatgcagggtcattacgaa
atgatcgatgaaaatggcgacgcctttaccatcgacattcccgtgtttcgactcgccgtc
cctacactcattcactaa

DBGET integrated database retrieval system