KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0296
Entry
SeSA_A0296        CDS       T00743                                 

Definition
(GenBank) ImpA-related N-family protein
  KO
K11902  type VI secretion system protein ImpA
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sew02044]
    SeSA_A0296
Secretion system [BR:sew02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeSA_A0296
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ACF91207
UniProt: A0A0N1TV24
Position
complement(306670..307713)
AA seq 347 aa
MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRL
LTRSKDIRVLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIE
DAALVRSNALAALLDHEGVMADIRGITLSNSAALRLQVRDVERALSAPRPADALAPESVR
QQLADLEARGALPLAAFREAQESAERLQVWARETLGDLAPDFSRLRQLLALLPDVVQTTT
PEIPPSPAPDPAGTVMVNAVPARAEDVPPVNTPPGISLPHNAEPGPIRDRNDALERLRCI
RRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgtccctgactaaaccggtaagcgcggaacaaccctgcggccccgatccggagtacgat
ccggagtacctgctgctgttcagccgcgccgccccccaggcggaggcgcaatatggtgat
tttgtcagtacgccggaagccgtgaactggccggaaattgagcgtgatgcgcgccgtctg
ctcacgcgcagtaaggatatccgggtgttgatcctgctgctgcgcagtcgcatccagcag
gctggcgcacagggactggcggaaatgctcacacaactggcagaactgagcgtaatctgg
tctgatgcactccatccacagctgcttaccggcgaaggcgcatccgcagaatctattgaa
gatgcggcgctggtgcgcagtaatgccctggcggcgctgctggatcacgaaggcgtgatg
gcagacattcgcggtatcacgctgtcaaacagtgccgccctgcgcctgcaggtacgggat
gtcgagcgcgcgttatccgctccccgcccggctgatgcgctggcccccgaatccgtccgc
cagcaactggccgacctcgaagcccgtggggcattaccgctggcggcgtttcgcgaagcg
caggaaagcgcagaacgcctgcaagtgtgggcgcgtgagacattaggcgatctggctcca
gatttttcacgcctgcggcagttgttggcgctgctgcctgacgtggtacagacaaccacg
ccggaaatccctccgtcgccagcgccagaccccgcaggcacggttatggttaatgccgtt
ccggcacgggcagaggatgtgccgcctgtcaacacgccccccggtatatccctcccacac
aatgctgaaccggggccaattcgcgatcgtaatgatgcgctggaacgcctgcggtgcatt
cgtcgctggtttgagagcagtgaacccagcagcccgaccatcccactgttacgccaggct
gaaagactggtgggaaaacggttctcggaggtgatcaatgaaatcccggtggagttgctg
gagaagtgggatgccctggaatga

DBGET integrated database retrieval system