KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0298
Entry
SeSA_A0298        CDS       T00743                                 

Gene name
vasA
Definition
(GenBank) type VI secretion protein, family
  KO
K11896  type VI secretion system protein ImpG
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sew02044]
    SeSA_A0298 (vasA)
Secretion system [BR:sew02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeSA_A0298 (vasA)
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ACF91565
UniProt: A0A0N1QYA1
Position
complement(308722..310605)
AA seq 627 aa
MDPRLLEYYNRELSYLRETGAEFATLHPKIAARLGMQGTDIADPYVERMIEAFSFLSART
QLKIDAEFPRFTQRLLEVVSPNYVTPTPSMAVVKLYPDTQEGDLAKGVTVPRDTAFVSPI
PEGENTACQFRSSQDVTLWPLSIEEVRLTAAPPDMPALHRYLPPNIHVAGALRITLRTFG
ELTFSELAGPARLPFYLCGEERIASHLFELLHTSAVATLAGEPGHFDGELNVNLQHPVAH
EGLEPGQGLLPLAWNVFHGHNLLHEFFACPERFYFFTPTGLSAGLQKVQGNVAEIVILLN
RLPPDWLIHQTDAAQFSLFCTPVINLFPRTTTRIEVTHSVTEQHLVVDRTRPLDYEVFSV
QEVEGLEAETTRKMIFRPLYHTRNNDEGNHGRYFSLRREPRRSSENARRYGTRTPYTGSE
IFLSLVDQHEAPYPENLRHITVTAMVTNRDLPCLIPRNGRDDLTVDAAIPVAGVGLIRPP
RPPQPPLAEREMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRS
LIGCKTTPVTRRLPGSGLLVYGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINT
FSQMTLHSMQRGHVMTWPVRTGQRGSV
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggatccacggctactggagtattacaaccgcgaactgagctacctgcgggagactggt
gctgagttcgccaccctccatcccaaaattgccgcccgactggggatgcagggaaccgat
attgccgacccgtatgtggaacgcatgatcgaggcgttcagctttctgagcgcccgtact
cagctaaaaattgacgccgagtttccccgcttcacacagcggttactggaagtcgtcagc
cccaattacgtcacccccacgccatcgatggcagtggtaaagctgtatcccgatacgcag
gaaggcgacctggcgaaaggggtcaccgtgccgcgcgataccgcgttcgtttcccctatc
ccggaaggcgaaaataccgcctgccagtttcgcagcagccaggacgtcacgctgtggccg
ctgtccatcgaggaggtacgcctgaccgccgcgccaccggatatgcccgccctgcaccgc
tatctgccgcctaatattcatgtcgccggggcattgcgcatcaccctgcgaaccttcggg
gaactgactttcagcgagctggccggtccggcacggctgcccttttacctctgcggcgaa
gaacgcattgcgtcacacctgtttgagctgctgcataccagcgccgtcgccacactggcc
ggtgaacccggtcactttgacggcgaactgaatgtgaatcttcaacacccggtggcgcac
gaagggctggagccagggcaggggctgctgccgctcgcctggaacgtgtttcacggccat
aatctgctgcatgaatttttcgcctgtccggaacggttttacttcttcaccccgaccgga
ttgtctgccgggttacaaaaggtgcagggcaatgtggcggaaattgtcatactgcttaat
cgcctgccgccggactggctgattcatcagacggacgctgcacagttcagcctgttctgt
acgccggtgatcaacctgtttccccgcaccaccacccggattgaagtcactcacagcgtg
acggaacagcatctggtggtagatcgtacccgtccgctggattacgaggtgttttctgtt
caggaagtcgaaggcctggaagcggaaaccacacggaagatgatttttcgtccgctgtat
cacacccgtaataatgacgaaggcaaccacgggcgttatttttcactgcgtcgtgaaccg
cgccgctcgtcagaaaatgcccgccgctatggcacccgaaccccctataccggctcggaa
atcttcctgtcgctggttgatcagcatgaagcgccctacccggaaaatctgcgccatatc
accgtcacggcaatggtgactaaccgcgatctgccctgtcttattccacgtaatggccgg
gatgatctgaccgtagatgcggcgatcccggtggcgggcgtgggtcttatcagaccgccg
cgcccgccgcagccgccgctggctgaacgcgaaatggcctggcggctgatccggcagttg
tcgtttaattatctgccgctggccgatctggatcaccgcaccggcggccaggcgctgcgc
gatctgctgaatctgtttattccggctcacgacagcccgcagtcgcgccaggtgcgcagc
ctgattggctgcaaaaccaccccagtaacccgccgcctgcccggctccggtctgttggtc
tatggccggggcgtcagttgcgaactgaccgtggacgaagaaggattttccggtatcagt
ccttacctgttcggtctggtgctggaacactatattgcccgccatgtttccattaatacc
ttctcacagatgacgctgcactcgatgcaacgcgggcatgtcatgacctggccggtaaga
accgggcaacgggggagcgtatga

DBGET integrated database retrieval system