KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0306
Entry
SeSA_A0306        CDS       T00743                                 

Definition
(GenBank) type VI secretion protein, EvpB/family
  KO
K11900  type VI secretion system protein ImpC
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sew02044]
    SeSA_A0306
Secretion system [BR:sew02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeSA_A0306
SSDB
Motif
Pfam: VipB VipB_2 Pro_3_hydrox_C
Other DBs
NCBI-ProteinID: ACF91096
UniProt: A0A0N1QXB7
Position
316860..318368
AA seq 502 aa
MANSNMQATDAVAQDTVSASGEFDALLNQAFRPKTTQAAKAVEAAVQTLAQQALANTITV
SDDAYKSISAIIAQIDFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFM
NLSKDELRRNMKRYKGIAWDQSPMFKKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLL
GSIAKVAASAHAPFIAGASPSVLQMDSWQELANPRDLTKIVTQNLEYAPWNSLRASEDSR
YIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAAYAMGVNINRSFKHYG
WCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPLIHRKN
SDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKER
EDMQRWLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQ
LEGLTGSLRLVTKLPSVKQGNA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcaaacagtaatatgcaggcaaccgacgcggttgctcaggataccgtctccgcatcc
ggtgaatttgatgcgttgctgaatcaggccttccgacccaagactacccaggcggcaaaa
gccgtggaagccgcggtgcagacgctggcgcaacaggcgctggcgaacacgatcaccgtc
agcgatgacgcttataaaagcatcagcgctattattgcgcagatcgactttaaactgacc
gaacagatcaaactgattctgcaacatcccgactggcagaagctggaatcctcctggcgc
ggtatggagcatctggtttacaacaccgagaccgacgaaaagctgaaaatccgcttcatg
aatctgtcaaaagatgaattgcggcgcaacatgaagcgttacaagggcatcgcctgggat
caaagcccgatgttcaagaaactgtatgaagccgaatacggccagttaggtggcgaacct
tatggctgtatcattgcggattactacttcgaccatacaccgcccgatgtggatctgctt
ggctctatcgccaaagtcgccgcgtcggcccatgcgccgtttattgccggggcttccccc
tcggtactgcaaatggactcctggcaggagctggcgaatccccgcgacctgaccaaaatc
gtcacccagaacctggaatatgcgccgtggaactcgctgcgggctagcgaagactcccgt
tatattggcctgacgatgccgcgttttcttgcccgcctgccgtatggcgcaaaaaccaac
ccggtggacgagtttgattttgaagaagatgcggatggttctgaccataccaaatacgtc
tggagcaacgcggcctacgcgatgggcgtaaacatcaaccgctccttcaaacactacggc
tggtgtacgttgattcgcggtgtggaatcaggcggtgcggtggaaaatcttccctgccat
accttcccgactgacgatggcggcgtggacatgaaatgcccgaccgaaatcgccatctct
gaccgccgcgaggctgaactggcgaaaaacggttttatcccgttgatccaccgtaaaaac
tcagactatgccgcctttatcggtgcacagtcgctgcaaaaaccacaggaatactacgat
ccggacgcgacggccaacgctaacctgtctgcccgtctgccgtacctgttcgcctgctcg
cgcttcgcgcacttcctcaaatgtatcgtccgcgacaaaatcggttcctttaaagagcgc
gaggatatgcagcgctggctaaatgaatggattatgaattacgtcgacgccgatccggtt
aactcctcgcaagaaactaaagcccgtcgtccgctggctgccgctgaagtagtggtggaa
gaggtggaaggcaatccaggttattacgacgcgaaattcttcctgcgtccgcatttccag
cttgaagggctgacgggatcgctgcgcctggtgacaaaactgccgtcagtgaagcagggc
aatgcctga

DBGET integrated database retrieval system