KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0311
Entry
SeSA_A0311        CDS       T00743                                 

Definition
(GenBank) hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sew00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeSA_A0311
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sew02044]
    SeSA_A0311
Secretion system [BR:sew02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeSA_A0311
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACF88743
UniProt: A0A0N1QS86
Structure
PDB: 
5XEU

Position
321030..321515
AA seq 161 aa
MSYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTHLSFEH
YIDRASPNLFKYCSSGKHIPQAILVMRKAGGNPLEYLKYTFTDLIIAMVSPSGSQGGEIA
SRESIELSFSTVKQEYVVQNQQGGSGGTITAGYDFKANKEI
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcttatgatatttttctgaaaattgacggcatcgacggtgagtcgatggatgacaaa
cacaaaaatgaaattgaagtactgagctggcgctggaatatccatcaggaatccaccatg
cacgccggtagcggtctcggttccggtaaagtatctgttactcatctttcatttgaacat
tacatcgatcgcgccagcccgaacctgttcaaatactgctcttctggcaagcacattccg
caggccattctggttatgcgtaaggctggcggcaatccgctggagtacctcaagtacacc
ttcacagatctgattattgcaatggtatcgcccagcggaagccagggaggggaaattgcg
tctcgcgaatcaattgaactctctttcagcaccgtgaagcaggaatacgtggtgcagaac
cagcagggcggcagcggcggcaccatcaccgcaggctacgacttcaaggccaacaaagaa
atttaa

DBGET integrated database retrieval system