KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0313
Entry
SeSA_A0313        CDS       T00743                                 

Definition
(GenBank) type VI secretion protein, family
  KO
K11893  type VI secretion system protein ImpJ
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
KEGG Orthology (KO) [BR:sew00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sew02044]
    SeSA_A0313
Secretion system [BR:sew02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeSA_A0313
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ACF90164
UniProt: A0A0N1QVB7
Position
322122..323465
AA seq 447 aa
MSWNDRVVWSEGQFLLPQMFQQQERYLEHVMHYRSLPLTPFFWGFSHYNIDGEALNIGKL
ILKEASGIFPDGTPFNAPDHTPLPPPLTILPEHLNQQICLAVPVRAPNSEETTFDNNPES
LARFSVHEHDIRDANSLGRGAQLLQLSHLRLRLLPEKAVTGAWIGLPLTRIIGLNPDGRI
DIDHDLIPPIINYQASSLMCTWLSWINDLIRMRADSLAERLTGSDNHGHEAAEVSDYLLL
QILNRFEPLLIHLAKTPLAPEVLYRYLSELAGELSTYVRPQTRRPAEYKEYKHLTPYAGL
KSLVDEVQFLLNAVLIRGAQRIELKEGTYGILNAVVAPSDLADFSTLVLAIKASMPTDVL
LQHFAAQTKIGPSDRLPELIRSHLPGLALQVLPVPPRQIPFQAGYIYYDIRREGALWEHI
ARYGGMAMHTAGEFPGLETELWGVRDK
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgagctggaatgaccgcgtagtctggagtgaaggacaatttttactgccgcagatgttt
cagcagcaagagcgttatctggaacacgtcatgcattaccgcagcctgccgctgaccccc
tttttctggggattcagccactacaatattgatggcgaagcgctgaacatcggtaaactg
atactgaaagaggcatcagggatttttcctgacggtacgccgtttaacgcaccggaccat
accccgctgccgccgccgctgaccatcctgccggagcacctgaaccagcagatttgtctg
gcggtaccggtacgcgcgccgaacagcgaagaaactacgtttgacaataacccggaatca
ctggcgcgtttctcggtacacgaacacgacatccgcgacgccaactcgctgggacgtggc
gcgcagttattacagctcagtcacctgcgcctgcggctgctgccggaaaaggcggtgacg
ggcgcctggattggcctgccgctgacccgcatcatcgggctgaatcctgacgggcggata
gatatcgaccacgacctgatcccgcccatcattaattatcaggccagttcactgatgtgt
acctggctgtcgtggatcaacgatctcatccggatgcgggccgattcgctggcggaacgg
ctgaccggcagcgacaaccacggccatgaagcagcggaggtctccgattacctgctgttg
caaattctcaatcgctttgagccgctgttgattcacctggcgaaaaccccgctggccccg
gaagtgttgtatcgctacctgtccgaactggccggggaactctccacctatgtgcgtcca
caaacgcgacggcccgctgaatacaaagagtacaaacacctgacgccctatgccgggttg
aaatcactggttgatgaggtgcagttcctgctgaatgcagtactgatccggggcgcgcag
cgcatcgagctgaaagaggggacttacggcatcctgaatgcggtggtggctccttccgat
cttgccgatttcagcacgctggtactggcgataaaggcttcaatgccgaccgatgtgcta
ctgcaacattttgccgcccagaccaaaatcgggccatccgatcgcctgccggaactgatc
cgctcgcatctgccggggctggctttgcaggttttgcctgtaccaccgcgccaaatcccg
tttcaggccggatacatctattacgacatccgccgcgagggagcattgtgggaacacatt
gcccgttacggcgggatggccatgcataccgccggggaatttccggggctggagacagaa
ctgtggggagtgcgcgataaatga

DBGET integrated database retrieval system