KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0322
Entry
SeSA_A0322        CDS       T00743                                 

Definition
(GenBank) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sew00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeSA_A0322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sew02044]
    SeSA_A0322
Secretion system [BR:sew02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeSA_A0322
SSDB
Motif
Pfam: Phage_GPD Phage_base_V
Other DBs
NCBI-ProteinID: ACF90586
UniProt: A0A0N1QW77
Position
332051..334243
AA seq 730 aa
MSFVSTNNKSGMGGLTTTTPPITGENSGTTAGSVAGSVAGAAEAAVEQALGSLMGDLPEP
SGLVKAAVAAAAQAAAAAGAAQDVISALISGATSGPGAHNVTVSGSAVPPQMLLFSSLNG
SEALGSLFTYIVQLKTPDTLNLGYVSPAANLPLKAMVGKDLCVNIELDGGGKRHISGLVT
AARVVGHEGRSVTYELRMEPWVKLLTHTSDYKAFQNKTVVDILDEVLAEYPYPVEKRLVE
SYPVRTWQVQYGETDFDFLQRLMQEWGIYWWFEHSEDSHTLVLADAISTHHACPDSPEVE
WHQKGLKLDKAFIHTIIANESLRTGQWVLDDFDFKKPRSRLANTVANPRETGHASYEHYE
WPGDYFDKGEGEMLTRIRMEAQRSPGSRVHGAGNIRTLMTGYTFALMNHPTAELNQEYLL
AQTTLFVQDNAQHSGQDQHFTFSTRFELHPTREVFRPQRTVSKPHTKGPQSAIVTGPAGQ
EIWTDQYGRVKVQFGWDRYGKMDENSSCWIRVSYPWAGKGFGMIQIPRIGQEVLVDFKNG
DPDLPIIVGRTYNQDTMPPWGLPGMASQSGIFSHSLYGGPTNGNMLRFDDKTGAEEVKFH
AEKDLNTTVKNNETHTVMVDRTKTIIKNETNSIGEDRNTTVTKNDGLSVKLAQTINIGTT
YRLDVGDQFTLRCGNAALVLHKDGSIEFCGKQLMLHTSDVMQLIGKGIDMNPDGGTAVTA
DDIAPLPTSE
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgagttttgtatccacaaataataaatccggtatgggggggctgacgacaaccacgccg
ccgataacaggtgaaaacagtggaactacagcaggttcggttgccggaagcgtggcggga
gccgcagaagcggcagtggaacaggcgctgggatctctgatgggcgacctgcctgaaccg
tcggggttggtgaaagcagcggtggctgcggcggcacaggctgcggcagcggcgggcgcg
gcgcaggatgtgatatcggcactaatttctggtgcaaccagcgggccgggcgcacataac
gtgacggtcagcggcagcgcagttccaccgcagatgctgctgttttccagtctgaacggc
tcggaagctctcggtagcttgtttacctacatcgtacagctaaaaacgcccgacaccctg
aatctgggctatgtctcccccgcagccaacctgccgcttaaagccatggtgggcaaagat
ttgtgcgtcaacatcgaactggatggcggcggcaaacggcatatcagcgggctggtcacg
gcggcgcgggtggtgggccatgaagggcgttctgttacctatgagctgcgtatggagccg
tgggtaaaactgctgacccacaccagcgactacaaggcattccagaataaaaccgtggtg
gacattctcgatgaagtgctggctgagtatccgtatccggtggaaaagcgactggtggaa
agctacccggtacgcacctggcaggtacagtacggtgaaactgattttgattttcttcag
cgactgatgcaggagtggggcatctactggtggtttgagcacagcgaggacagccacacg
ctggtgctggcggatgccatcagtacacatcacgcctgcccggattcaccggaggtagaa
tggcatcaaaaagggttaaagctggataaagcatttatccacaccattatagccaatgaa
agtctgcgtaccgggcagtgggtactggatgattttgactttaaaaaaccgcgctcgcgg
ctggcgaacacagtggcaaacccgcgtgaaaccggccatgccagttacgaacactacgaa
tggccgggcgattatttcgacaagggcgaaggcgaaatgctgacgcgcattcgtatggaa
gcgcagcgcagccctggcagccgggttcacggtgccgggaatatccgtacgctgatgact
ggctacacctttgcgttgatgaatcaccctacggcagaactcaaccaggaatatctgttg
gcgcagactacgctgtttgtgcaggacaacgcgcagcacagcgggcaggaccagcacttt
accttttccacccgttttgaactgcacccgacccgtgaggtgttccgcccgcagcggacg
gtgagcaaaccccacaccaaagggccgcagagcgccatcgtcaccggcccggcgggccag
gaaatctggacggatcagtacgggcgggtaaaggtgcagtttggctgggaccgttacggc
aaaatggatgaaaacagctcctgctggatacgcgtcagctacccatgggcgggcaaaggc
ttcgggatgatccagatcccgcgtatcggccaggaagtgctggtggatttcaaaaacggc
gatccggatctgccgatcatcgtggggcgtacctacaaccaggacaccatgccgccgtgg
ggactgccgggaatggcgtcgcagagcgggatcttcagccactcgctgtatggcgggcca
acgaacggcaacatgctgcgttttgacgacaaaaccggcgcggaggaagtgaagttccac
gcggaaaaagatctcaacaccacggtgaagaataatgaaacgcatacggttatggtggat
cgcactaaaaccattattaaaaatgaaaccaacagtattggtgaggacagaaacaccacg
gtaacgaagaatgacggcctttccgtaaaactggcgcagacgatcaatatcggcaccact
tatcgtttagatgttggcgatcaattcacgcttcgctgcggcaatgcggcgcttgtttta
cataaggacggctccattgagttttgtggcaagcaactgatgttacataccagcgatgtc
atgcaactgattggtaaaggtattgatatgaacccggatggcggcacagccgtaaccgcc
gatgatattgccccccttcccacctctgaatga

DBGET integrated database retrieval system